Gene Information

Name : vicR (MGAS10750_Spy0455)
Accession : YP_601949.1
Strain : Streptococcus pyogenes MGAS10750
Genome accession: NC_008024
Putative virulence/resistance : Virulence
Product : two-component response regulator VicR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 443086 - 443796 bp
Length : 711 bp
Strand : +
Note : -

DNA sequence :
ATGAAAAAAATACTTATTGTGGATGATGAAAAACCGATTTCTGACATTATTAAGTTTAATTTGACAAAAGAAGGTTATGA
CATTGTTACAGCTTTTGATGGACGCGAAGCGGTAACCATTTTTGAAGAAGAAAAGCCAGATTTAATTATTCTTGATTTGA
TGCTCCCTGAGTTGGACGGTCTTGAAGTAGCCAAGGAAATTCGTAAAACCAGTCATGTCCCGATTATTATGTTGTCGGCT
AAAGATAGTGAGTTTGACAAGGTTATTGGACTTGAAATTGGGGCTGATGATTACGTGACCAAGCCCTTTTCTAATCGGGA
ATTGCTGGCGCGTGTCAAGGCTCATCTGCGTCGTACCGAAACTATTGAAACGGCTGTTGCAGAAGAAAATGCTTCTTCAG
GTACACAGGAACTAACCATTGGTAATTTACAGATTTTACCAGATGCGTTTGTTGCTAAAAAACATGGTCAAGAGGTAGAG
TTGACTCATCGTGAATTTGAACTATTGCATCATCTAGCTAACCATATGGGTCAGGTGATGACACGAGAACACTTATTGGA
AATTGTTTGGGGATATGATTATTTTGGCGATGTGCGCACGGTTGATGTGACTGTTCGTCGTCTCCGTGAAAAAATTGAAG
ACACACCAAGTCGTCCTGAGTATATTTTAACAAGACGTGGTGTTGGGTACTACATGAAATCTTATGACTAG

Protein sequence :
MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGREAVTIFEEEKPDLIILDLMLPELDGLEVAKEIRKTSHVPIIMLSA
KDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRRTETIETAVAEENASSGTQELTIGNLQILPDAFVAKKHGQEVE
LTHREFELLHHLANHMGQVMTREHLLEIVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYILTRRGVGYYMKSYD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-35 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
vicR YP_601949.1 two-component response regulator VicR NC_012469.1.7685629. Protein 1e-81 80
vicR YP_601949.1 two-component response regulator VicR HE999704.1.gene2815. Protein 4e-50 53
vicR YP_601949.1 two-component response regulator VicR NC_002952.2859905.p0 Protein 1e-49 51
vicR YP_601949.1 two-component response regulator VicR NC_009641.5332272.p0 Protein 1e-49 51
vicR YP_601949.1 two-component response regulator VicR NC_013450.8614421.p0 Protein 1e-49 51
vicR YP_601949.1 two-component response regulator VicR NC_007793.3914279.p0 Protein 1e-49 51
vicR YP_601949.1 two-component response regulator VicR NC_002745.1124361.p0 Protein 1e-49 51
vicR YP_601949.1 two-component response regulator VicR NC_009782.5559369.p0 Protein 1e-49 51
vicR YP_601949.1 two-component response regulator VicR NC_002951.3237708.p0 Protein 1e-49 51
vicR YP_601949.1 two-component response regulator VicR NC_007622.3794472.p0 Protein 1e-49 51
vicR YP_601949.1 two-component response regulator VicR NC_002758.1121668.p0 Protein 1e-49 51
vicR YP_601949.1 two-component response regulator VicR NC_003923.1003749.p0 Protein 8e-50 51
vicR YP_601949.1 two-component response regulator VicR NC_012469.1.7686381. Protein 5e-42 48
vicR YP_601949.1 two-component response regulator VicR AE016830.1.gene1681. Protein 8e-44 47
vicR YP_601949.1 two-component response regulator VicR FJ349556.1.orf0.gene Protein 4e-38 44
vicR YP_601949.1 two-component response regulator VicR CP000647.1.gene4257. Protein 1e-30 44
vicR YP_601949.1 two-component response regulator VicR CP004022.1.gene3215. Protein 9e-33 44
vicR YP_601949.1 two-component response regulator VicR NC_002695.1.915041.p Protein 4e-30 44
vicR YP_601949.1 two-component response regulator VicR BAC0533 Protein 1e-30 44
vicR YP_601949.1 two-component response regulator VicR CP000034.1.gene3834. Protein 4e-30 44
vicR YP_601949.1 two-component response regulator VicR AF155139.2.orf0.gene Protein 1e-37 43
vicR YP_601949.1 two-component response regulator VicR AM180355.1.gene1830. Protein 7e-37 43
vicR YP_601949.1 two-component response regulator VicR DQ212986.1.gene4.p01 Protein 4e-37 43
vicR YP_601949.1 two-component response regulator VicR CP001138.1.gene4273. Protein 3e-30 43
vicR YP_601949.1 two-component response regulator VicR AF162694.1.orf4.gene Protein 3e-34 42
vicR YP_601949.1 two-component response regulator VicR NC_005054.2598277.p0 Protein 1e-35 41
vicR YP_601949.1 two-component response regulator VicR NC_014475.1.orf0.gen Protein 1e-35 41
vicR YP_601949.1 two-component response regulator VicR AE000516.2.gene3505. Protein 1e-33 41
vicR YP_601949.1 two-component response regulator VicR NC_013450.8614146.p0 Protein 3e-34 41
vicR YP_601949.1 two-component response regulator VicR NC_002951.3238224.p0 Protein 3e-34 41
vicR YP_601949.1 two-component response regulator VicR NC_007793.3914065.p0 Protein 3e-34 41
vicR YP_601949.1 two-component response regulator VicR NC_002758.1121390.p0 Protein 3e-34 41
vicR YP_601949.1 two-component response regulator VicR NC_010079.5776364.p0 Protein 3e-34 41
vicR YP_601949.1 two-component response regulator VicR AE015929.1.gene1106. Protein 2e-30 41
vicR YP_601949.1 two-component response regulator VicR NC_002952.2859858.p0 Protein 3e-34 41
vicR YP_601949.1 two-component response regulator VicR NC_007622.3794948.p0 Protein 3e-34 41
vicR YP_601949.1 two-component response regulator VicR NC_003923.1003417.p0 Protein 3e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
vicR YP_601949.1 two-component response regulator VicR VFG1389 Protein 3e-32 43
vicR YP_601949.1 two-component response regulator VicR VFG1563 Protein 5e-35 42
vicR YP_601949.1 two-component response regulator VicR VFG1702 Protein 5e-35 41