Gene Information

Name : Dgeo_2564 (Dgeo_2564)
Accession : YP_594072.1
Strain :
Genome accession: NC_008010
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 489269 - 490003 bp
Length : 735 bp
Strand : -
Note : -

DNA sequence : 
ATGCGGTCAGAAGCGAAACGGATCCCTCGACGCGGAGACCCCGTGCCCACTGTCCTGATTGTCGATGACGACCCGGCCAT
CCTGGAAATCCTGCGGGTGTATCTGCGCCAGGACGGCTTCCGGGTGCTGGAAGCCCGCGAGGGCGCGCAGGCGCTGAGCC
TGTTGCCGCAGGCGGACGTCGCGGTGCTCGACTGGATGCTGCCGGGCATGACCGGCCTGGAACTCGCCCGGCGCGCCCAC
GCCACCTTTCCGGAGGTGCCCCTCCTGATGCTGACCGCGCGCGATGGGGAAGAGGACAAGCTGCTCGGCCTGGAGGGTGG
GGCCGACGATTACGTCACCAAGCCCTTCTCGCCGCGCGAGGTGGTCGCGCGCCTCAAGGTGCTGCTGCGCCGCATGGGGG
TGCGGGAGGTGATCGAGCACGGCGAGTTGCACCTGGATGTGCGGGCGCGGGCCGCCACCCTGCGGGGCGAGGCGCTCGGC
CTGTCCAAGCTGGAGTTCGACCTGCTGTTCACCCTGGCCCAGTACCCCGGGCTGGCCTGGACCCGCGAGCGGCTGCTCGA
GCGGGTGTGGGGGGTGGACTATCCCCGGATGGAGCGCGTGGTGGACGTGCATATCACCGGGCTGCGCCGCAAGCTGGGGG
ACCATGCCGAGCACCCCAGGTACATTGAGACGGTGCGGGGCGTGGGCTACCGGTTCCGGGAGAACGGGCAAGGCGGGGGT
GCGGGGACGCCGTGA

Protein sequence : 
MRSEAKRIPRRGDPVPTVLIVDDDPAILEILRVYLRQDGFRVLEAREGAQALSLLPQADVAVLDWMLPGMTGLELARRAH
ATFPEVPLLMLTARDGEEDKLLGLEGGADDYVTKPFSPREVVARLKVLLRRMGVREVIEHGELHLDVRARAATLRGEALG
LSKLEFDLLFTLAQYPGLAWTRERLLERVWGVDYPRMERVVDVHITGLRRKLGDHAEHPRYIETVRGVGYRFRENGQGGG
AGTP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-15 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dgeo_2564 YP_594072.1 two component transcriptional regulator NC_012469.1.7685629. Protein 4e-30 46
Dgeo_2564 YP_594072.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-28 43
Dgeo_2564 YP_594072.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-29 43
Dgeo_2564 YP_594072.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-29 43
Dgeo_2564 YP_594072.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-29 43
Dgeo_2564 YP_594072.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-29 43
Dgeo_2564 YP_594072.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-29 43
Dgeo_2564 YP_594072.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-29 43
Dgeo_2564 YP_594072.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-29 43
Dgeo_2564 YP_594072.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-29 43
Dgeo_2564 YP_594072.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-29 43
Dgeo_2564 YP_594072.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-29 43
Dgeo_2564 YP_594072.1 two component transcriptional regulator NC_002695.1.916589.p Protein 3e-27 43
Dgeo_2564 YP_594072.1 two component transcriptional regulator AE016830.1.gene1681. Protein 5e-31 42
Dgeo_2564 YP_594072.1 two component transcriptional regulator NC_012469.1.7686381. Protein 6e-30 42
Dgeo_2564 YP_594072.1 two component transcriptional regulator HE999704.1.gene2815. Protein 5e-34 42
Dgeo_2564 YP_594072.1 two component transcriptional regulator BAC0197 Protein 7e-17 42
Dgeo_2564 YP_594072.1 two component transcriptional regulator CP000034.1.gene2186. Protein 4e-27 42
Dgeo_2564 YP_594072.1 two component transcriptional regulator CP001138.1.gene2239. Protein 3e-26 42
Dgeo_2564 YP_594072.1 two component transcriptional regulator BAC0039 Protein 4e-27 42
Dgeo_2564 YP_594072.1 two component transcriptional regulator BAC0596 Protein 3e-26 42
Dgeo_2564 YP_594072.1 two component transcriptional regulator CP001918.1.gene3444. Protein 2e-26 41
Dgeo_2564 YP_594072.1 two component transcriptional regulator CP000647.1.gene2531. Protein 5e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dgeo_2564 YP_594072.1 two component transcriptional regulator VFG1389 Protein 5e-23 43
Dgeo_2564 YP_594072.1 two component transcriptional regulator VFG1390 Protein 3e-26 42
Dgeo_2564 YP_594072.1 two component transcriptional regulator VFG1386 Protein 1e-24 42