Gene Information

Name : copR2 (Rmet_5672)
Accession : YP_587800.1
Strain :
Genome accession: NC_007974
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator in two-component regulatory system with CopS
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2431333 - 2432019 bp
Length : 687 bp
Strand : +
Note : -

DNA sequence :
ATGAAGCTCCTGGTGGTCGAGGACGAAACCAAGACTGGCGAATACCTGAGGCAGGGCCTGACCGAGGCCGGCTTCATCGT
GGACCTCGTGCATAGCGGGCTGGACGGCCAGCATATGGCGCTGAACGAGTCCTACGACCTGCTGATCCTCGATGTGATGC
TGCCCGATATCGATGGCTGGCGCATCCTGCAGAACATCCGTGCCGCCGGCAATCCCGTGCCGGTGCTGTTCCTGACGGCC
CGTGACAGCGTCGCCGACCGCGTGAAGGGGCTGGAACTCGGCGCGGACGACTACCTCGTCAAGCCGTTCGCGTTCTCCGA
ACTGCTGGCCCGCGTGCGCACGCTGTTGCGCCGGGGTGCCGCGCAGGCACCGGTCGATCGTATCCAGATCGCCGATCTCG
TGCTGGACCTGGCCCGACGCAGAGCCACGCGCGCCGGGCGCAGGATCGTGCTGACCGGCAAGGAATTCGCGCTGCTGGAA
CTGCTGGCCCGCCGCCGTGGCGAGGTATTGCCGCGTTCGCTGATCGCCTCGCAGGTCTGGGACATGAACTTCGACAGCGA
CAGCAATGTGATCGACGTGGCGATCCGCCGCCTGCGCGCGAAGATCGACGATGACTTCGACGATAAGCTGATCCAGACCG
TGCGTGGCATGGGATATGTGCTGGAAGCGCCGGAGGATCTGGCCTGA

Protein sequence :
MKLLVVEDETKTGEYLRQGLTEAGFIVDLVHSGLDGQHMALNESYDLLILDVMLPDIDGWRILQNIRAAGNPVPVLFLTA
RDSVADRVKGLELGADDYLVKPFAFSELLARVRTLLRRGAAQAPVDRIQIADLVLDLARRRATRAGRRIVLTGKEFALLE
LLARRRGEVLPRSLIASQVWDMNFDSDSNVIDVAIRRLRAKIDDDFDDKLIQTVRGMGYVLEAPEDLA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-46 59
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-46 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS BAC0083 Protein 8e-58 73
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS BAC0638 Protein 6e-60 71
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS BAC0197 Protein 5e-52 68
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS BAC0111 Protein 2e-58 67
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS BAC0308 Protein 1e-51 64
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS BAC0347 Protein 1e-50 62
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS BAC0125 Protein 1e-50 62
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS NC_002758.1121390.p0 Protein 5e-27 43
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS NC_010079.5776364.p0 Protein 5e-27 43
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS NC_002952.2859858.p0 Protein 5e-27 43
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS NC_007622.3794948.p0 Protein 5e-27 43
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS NC_003923.1003417.p0 Protein 5e-27 43
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS NC_013450.8614146.p0 Protein 5e-27 43
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS NC_002951.3238224.p0 Protein 5e-27 43
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS NC_007793.3914065.p0 Protein 5e-27 43
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS BAC0487 Protein 1e-21 41
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS NC_002952.2859905.p0 Protein 1e-23 41
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS NC_007622.3794472.p0 Protein 1e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS VFG0596 Protein 4e-47 59
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS VFG1390 Protein 1e-31 46
copR2 YP_587800.1 DNA-binding response regulator in two-component regulatory system with CopS VFG1389 Protein 3e-22 43