Gene Information

Name : merP (Rmet_2314)
Accession : YP_584462.1
Strain : Cupriavidus metallidurans CH34
Genome accession: NC_007973
Putative virulence/resistance : Resistance
Product : Mercuric transport protein periplasmic protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 2532535 - 2532822 bp
Length : 288 bp
Strand : +
Note : -

DNA sequence :
ATGAAGAAACTCACCACCCTCACCACCCTCATCGCCCTGGCCGCCGCTCTAAGCGCGCCCGCCTGGGCTGCCACCAAGAC
CGTCACCCTGTCGGTGCCCGGCATGACCTGCGCCGCGTGCCCGATCACGGTCAAGACGGCTCTGTCCAAGGTCGCCGGCG
TCGAGAAGGCCGAAGTCAGCTTCGAGAAGCGGGAGGCCGTCGTCACCTTCGACGAGGCCAAGACCAATGCCGACGCCTTG
ACCAAGGCCACCGCAAACGCGGGTTACCCGTCCAGCGTCAAGCAGTGA

Protein sequence :
MKKLTTLTTLIALAAALSAPAWAATKTVTLSVPGMTCAACPITVKTALSKVAGVEKAEVSFEKREAVVTFDEAKTNADAL
TKATANAGYPSSVKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 7e-26 100
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 2e-22 80
merP AGK07023.1 MerP Not tested SGI1 Protein 1e-21 78
merP AGK07081.1 MerP Not tested SGI1 Protein 1e-21 78
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 2e-21 78
merP ABQ57373.1 MerP Not tested SGI1 Protein 1e-21 78
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 1e-21 78
merP AFG30122.1 MerP Not tested PAGI-2 Protein 1e-21 78
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-21 76
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 2e-21 76

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merP YP_584462.1 Mercuric transport protein periplasmic protein BAC0678 Protein 3e-21 76
merP YP_584462.1 Mercuric transport protein periplasmic protein BAC0679 Protein 5e-21 76
merP YP_584462.1 Mercuric transport protein periplasmic protein BAC0231 Protein 2e-20 75
merP YP_584462.1 Mercuric transport protein periplasmic protein BAC0675 Protein 4e-19 68
merP YP_584462.1 Mercuric transport protein periplasmic protein BAC0674 Protein 2e-17 62