Gene Information

Name : agrR (Rmet_1751)
Accession : YP_583899.1
Strain : Cupriavidus metallidurans CH34
Genome accession: NC_007973
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator in two-component regulatory system with AgrS
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1900803 - 1901477 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGAAGATCTTGGTAATCGAAGATGAACCTAAGACTGGCGAGTACCTCCGAAAAGGCCTCACCGAGTCATCTTTCGTTGT
CGATCTTGCGTCGACAGGACGGGATGGCCTGCACCACGCAATCGACGGGGACTACGATCTGGTCATTCTTGATGTCATGC
TGCCTGGCATGAACGGATGGGAAGTGCTCAAGGAACTCCGGGAACACAAAGATACTCCCGTGCTCTTCCTGACCGCACGC
GATGAAGTCGAGGACAGAGTGAAAGGGCTCGAGCTTGGCGGCGATGACTACCTCGCAAAACCCTTTGCTTTCGTCGAATT
GCTGGCGCGGGCCCGGACGCTGCTGCGGCGCGGACCCACGCGCGAAGCTGAGCGCATCGAAATCGAGGACTTGGAGATCG
ACCTTTTGCGTCACCGAGTCTCCAGAGGAGGGATACGCATCGACTTGTCGCCCAGGGAGTTCGCATTGCTCCACTTCCTC
GCGCGACGACACGGCGAAGTCCTTAGTCGCACGCAAATCGCCTCACACGTTTGGGATATGAACTTCGACAGCGACACGAA
CGTCGTGGACGTGGCGATTCGACGCCTTCGAGCGAAGATGGATGACACTTACGCTCCCAAACTTATCCATAGCGTCCGCG
GCATCGGCTACGTCCTTGAGAACCGACAGTCTTGA

Protein sequence :
MKILVIEDEPKTGEYLRKGLTESSFVVDLASTGRDGLHHAIDGDYDLVILDVMLPGMNGWEVLKELREHKDTPVLFLTAR
DEVEDRVKGLELGGDDYLAKPFAFVELLARARTLLRRGPTREAERIEIEDLEIDLLRHRVSRGGIRIDLSPREFALLHFL
ARRHGEVLSRTQIASHVWDMNFDSDTNVVDVAIRRLRAKMDDTYAPKLIHSVRGIGYVLENRQS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-52 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-51 57

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS BAC0125 Protein 3e-62 66
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS BAC0197 Protein 2e-60 64
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS BAC0638 Protein 2e-51 61
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS BAC0111 Protein 2e-58 60
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS BAC0083 Protein 3e-57 60
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS BAC0308 Protein 4e-55 58
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS BAC0347 Protein 5e-50 57
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS NC_007622.3794948.p0 Protein 7e-32 43
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS NC_003923.1003417.p0 Protein 7e-32 43
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS NC_013450.8614146.p0 Protein 7e-32 43
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS NC_002951.3238224.p0 Protein 7e-32 43
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS NC_007793.3914065.p0 Protein 7e-32 43
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS NC_002758.1121390.p0 Protein 7e-32 43
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS NC_010079.5776364.p0 Protein 7e-32 43
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS NC_002952.2859858.p0 Protein 7e-32 43
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS AE015929.1.gene1106. Protein 3e-27 42
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS AE000516.2.gene3505. Protein 1e-27 42
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS HE999704.1.gene1528. Protein 1e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS VFG0596 Protein 2e-52 58
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS VFG1386 Protein 1e-31 43
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS VFG1389 Protein 2e-28 43
agrR YP_583899.1 DNA-binding response regulator in two-component regulatory system with AgrS VFG1390 Protein 1e-30 42