Gene Information

Name : Rmet_1173 (Rmet_1173)
Accession : YP_583328.1
Strain : Cupriavidus metallidurans CH34
Genome accession: NC_007973
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1284117 - 1284917 bp
Length : 801 bp
Strand : +
Note : -

DNA sequence :
ATGGCGGATTTCTGCACAATAGAGCCAGTTCAGAACCGAGGGCCAAGCCGCCGCACCATGGAACACGCCAAACGCATCCT
GCTGGTCGAAGACGATGTCGGTATCGCCAACGTGCTGGCCATGCACCTGCGCGACGAGCGCTACGAAGTCGTGCATAGCG
CCGATGGCGCCGAGGGGCTGCGCCTGCTGGAGCAGGGCGGTTGGGATGCGCTGGTGCTGGACCTGATGCTGCCCGGCGTG
GATGGTCTCGAGATCTGCCGCCGGGCCCGGGCGATGACGCGCTACACGCCGATCATCATCACCAGCGCGCGTTCCAGCGA
GGTGCATCGCATCCTGGGGCTCGAACTCGGTGCCGACGACTATCTGGCCAAGCCGTTCTCGGTGCTGGAGCTGGTGGCGC
GCGTCAAGGCGCTGCTGCGTCGAGTGGAGGCAATGGCGCGCGATGTGCGGGCCGATGCCGGCAGTCTGGAGCTGGCCGGA
CTGGCCATTGATCCTCTCGCGCGAGAGGCCGCTGTCGACGGCAAGCGCCTCGACCTGACCCCGCGCGAGTTCGACCTGCT
GTACTACTTCGCGCGCCATCCGGACAAGGTGTTCTCCCGCATGGACTTGCTCAACGCGGTGTGGGGCTACCAGCACGAGG
GTTACGAGCACACGGTGAACACGCATATCAACCGGCTGCGCACCAAGATCGAGGTCGATCCGGCGCAGCCGAAGCGCATC
CTGACTGTGTGGCGGCGCGGCTATCGGTTCGTGGCCGATCCGCAAGCCGACGCCGCGCAGGACGAAGGGGAAGCATCGTG
A

Protein sequence :
MADFCTIEPVQNRGPSRRTMEHAKRILLVEDDVGIANVLAMHLRDERYEVVHSADGAEGLRLLEQGGWDALVLDLMLPGV
DGLEICRRARAMTRYTPIIITSARSSEVHRILGLELGADDYLAKPFSVLELVARVKALLRRVEAMARDVRADAGSLELAG
LAIDPLAREAAVDGKRLDLTPREFDLLYYFARHPDKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRTKIEVDPAQPKRI
LTVWRRGYRFVADPQADAAQDEGEAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-71 62
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-71 62

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rmet_1173 YP_583328.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 5e-41 44
Rmet_1173 YP_583328.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 4e-35 43
Rmet_1173 YP_583328.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-41 42
Rmet_1173 YP_583328.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-39 42
Rmet_1173 YP_583328.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-40 42
Rmet_1173 YP_583328.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-29 41
Rmet_1173 YP_583328.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 3e-32 41
Rmet_1173 YP_583328.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-37 41
Rmet_1173 YP_583328.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 5e-41 41
Rmet_1173 YP_583328.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 3e-31 41
Rmet_1173 YP_583328.1 winged helix family two component transcriptional regulator BAC0596 Protein 3e-30 41
Rmet_1173 YP_583328.1 winged helix family two component transcriptional regulator BAC0039 Protein 3e-31 41
Rmet_1173 YP_583328.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 3e-30 41
Rmet_1173 YP_583328.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 3e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rmet_1173 YP_583328.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-71 62
Rmet_1173 YP_583328.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-71 62
Rmet_1173 YP_583328.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-29 43