Gene Information

Name : czcR (Rmet_5978)
Accession : YP_581787.1
Strain :
Genome accession: NC_007971
Putative virulence/resistance : Virulence
Product : regulatory protein CzcR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 82646 - 83323 bp
Length : 678 bp
Strand : +
Note : two components regulatory system involved in Cd(II), Zn(II), Co(II) resistance

DNA sequence : 
GTGCGGGTACTTGTTGTAGAAGACGAACCGCGTACTGCGGAGTATTTGCAGAAGGGATTGTCGGAGTCGGGTTTCGTGGT
CGACATCGCGAACAATGGTGGCGATGGGCTCCACATGGCGGAAGAGACCGACTACGACGTCATCATCCTGGACGTCATGC
TGCCAGGTATGGACGGGTGGACGGTCATCAAGTCCATTCGATCCAAGTCCGAGACACCCGTACTGTTTCTGACGGCGCTG
GATGATGTGGCGGATCGTGTCAGAGGCTTCGAGTTGGGGGCAGACGATTACCTGGTCAAGCCCTTCGCCTTTGCCGAGCT
CCTTGCCCGTATCCGGCGTTGCTTGCGCCAAAGCACCTCGAAGGAGTCCGAGCGATTGCGCATTGCCGATCTGGACATCG
ACGTGCTTGGAAGGCGGGTATTCCGGGGAACTACCCGCATTGAATTGACGAATCAGGAGTTCTCGCTGTTGCACCTGCTC
ATGCGCCGGAGAGGGGAGGTGCTGTCGCGAACCACGATCGCGTCCCAGGTCTGGGGCGTCAACTTCGACACGGATACCAA
TGTCGTTGACGTCGCGATCCGGCGCCTGAGATCCAAGGTGGATGATCCCTTCGATCAAAAGCTGATCCATACCGTACGGG
GAATGGGCTATGTCCTCGACCCAGAGCGCGGCCGGTGA

Protein sequence : 
MRVLVVEDEPRTAEYLQKGLSESGFVVDIANNGGDGLHMAEETDYDVIILDVMLPGMDGWTVIKSIRSKSETPVLFLTAL
DDVADRVRGFELGADDYLVKPFAFAELLARIRRCLRQSTSKESERLRIADLDIDVLGRRVFRGTTRIELTNQEFSLLHLL
MRRRGEVLSRTTIASQVWGVNFDTDTNVVDVAIRRLRSKVDDPFDQKLIHTVRGMGYVLDPERGR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-53 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-52 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_581787.1 regulatory protein CzcR BAC0125 Protein 3e-96 100
czcR YP_581787.1 regulatory protein CzcR BAC0197 Protein 7e-63 64
czcR YP_581787.1 regulatory protein CzcR BAC0083 Protein 6e-59 60
czcR YP_581787.1 regulatory protein CzcR BAC0638 Protein 6e-52 60
czcR YP_581787.1 regulatory protein CzcR BAC0308 Protein 1e-53 58
czcR YP_581787.1 regulatory protein CzcR BAC0111 Protein 2e-58 56
czcR YP_581787.1 regulatory protein CzcR BAC0347 Protein 6e-54 53
czcR YP_581787.1 regulatory protein CzcR NC_003923.1003417.p0 Protein 2e-35 44
czcR YP_581787.1 regulatory protein CzcR NC_013450.8614146.p0 Protein 2e-35 44
czcR YP_581787.1 regulatory protein CzcR NC_002951.3238224.p0 Protein 2e-35 44
czcR YP_581787.1 regulatory protein CzcR NC_007793.3914065.p0 Protein 2e-35 44
czcR YP_581787.1 regulatory protein CzcR NC_002758.1121390.p0 Protein 2e-35 44
czcR YP_581787.1 regulatory protein CzcR NC_010079.5776364.p0 Protein 2e-35 44
czcR YP_581787.1 regulatory protein CzcR NC_002952.2859858.p0 Protein 2e-35 44
czcR YP_581787.1 regulatory protein CzcR NC_007622.3794948.p0 Protein 2e-35 44
czcR YP_581787.1 regulatory protein CzcR AE015929.1.gene1106. Protein 4e-31 43
czcR YP_581787.1 regulatory protein CzcR AE000516.2.gene3505. Protein 4e-29 43
czcR YP_581787.1 regulatory protein CzcR NC_002952.2859905.p0 Protein 1e-28 42
czcR YP_581787.1 regulatory protein CzcR HE999704.1.gene1528. Protein 2e-27 42
czcR YP_581787.1 regulatory protein CzcR NC_009782.5559369.p0 Protein 1e-28 41
czcR YP_581787.1 regulatory protein CzcR NC_002951.3237708.p0 Protein 1e-28 41
czcR YP_581787.1 regulatory protein CzcR NC_003923.1003749.p0 Protein 1e-28 41
czcR YP_581787.1 regulatory protein CzcR NC_007622.3794472.p0 Protein 7e-29 41
czcR YP_581787.1 regulatory protein CzcR NC_002758.1121668.p0 Protein 1e-28 41
czcR YP_581787.1 regulatory protein CzcR NC_009641.5332272.p0 Protein 1e-28 41
czcR YP_581787.1 regulatory protein CzcR NC_013450.8614421.p0 Protein 1e-28 41
czcR YP_581787.1 regulatory protein CzcR NC_007793.3914279.p0 Protein 1e-28 41
czcR YP_581787.1 regulatory protein CzcR NC_002745.1124361.p0 Protein 1e-28 41
czcR YP_581787.1 regulatory protein CzcR AE016830.1.gene1681. Protein 3e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_581787.1 regulatory protein CzcR VFG0596 Protein 4e-54 56
czcR YP_581787.1 regulatory protein CzcR VFG1390 Protein 6e-37 44
czcR YP_581787.1 regulatory protein CzcR VFG1389 Protein 1e-30 44
czcR YP_581787.1 regulatory protein CzcR VFG1386 Protein 3e-33 42