Gene Information

Name : Pcryo_0771 (Pcryo_0771)
Accession : YP_580038.1
Strain : Psychrobacter cryohalolentis K5
Genome accession: NC_007969
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 907854 - 908429 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
ATGGCATTATCTCTAAATAAAGGCGGTAATTTATCGCTAACCAAAACGGATCCAAACTTAACTAAGCTGCTTATTGGTCT
TGGTTGGGATGAGCGTGCAACCTCTGGTGCCGAATTCGATCTTGATGCAAGCGTATTCTTATTAAATGCCGCTGGCAAAG
TACGCGGCGACCATGACTTTATCTTTTATAACCAACTCAAGTCTGACAATGGTGCAGTAGAGCATACTGGTGATAACCGT
ACAGGCGAAGGCGACGGTGATGACGAAGTGGTCAAAGTCAACCTAACGCAAGTACCTGCCGATGTCGATAAAATCGTTGT
TACAGTCACTATTCATGATGCAGCGGCTCGTAGCCAAAACTTCGGTCAAGTTGCTAATGCCTTCATTCGCGTTGTGAATG
AAGAAACGGGTGCTGAAGTGGTCCGTTTTGATTTAGCAGAAGACTACTCTGTTGAGACAGCAATGGTATTTGGAGAAGTC
TATCGCCACAATGCAGAATGGAAATTCCGCGCCGTTGGTCAAGGTTACTCTGGTGGCTTACAAGCGATGTGCCAGCAATA
TGGTGTCGTTATTTAA

Protein sequence :
MALSLNKGGNLSLTKTDPNLTKLLIGLGWDERATSGAEFDLDASVFLLNAAGKVRGDHDFIFYNQLKSDNGAVEHTGDNR
TGEGDGDDEVVKVNLTQVPADVDKIVVTVTIHDAAARSQNFGQVANAFIRVVNEETGAEVVRFDLAEDYSVETAMVFGEV
YRHNAEWKFRAVGQGYSGGLQAMCQQYGVVI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-68 72
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 7e-65 66
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-65 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-65 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-54 62
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-54 62
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-55 62
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-55 61
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-25 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-25 42
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 9e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pcryo_0771 YP_580038.1 stress protein BAC0389 Protein 4e-65 67
Pcryo_0771 YP_580038.1 stress protein BAC0390 Protein 7e-59 63