Gene Information

Name : Nham_2996 (Nham_2996)
Accession : YP_578212.1
Strain : Nitrobacter hamburgensis X14
Genome accession: NC_007964
Putative virulence/resistance : Unknown
Product : IS66 Orf2 like
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 3302776 - 3303123 bp
Length : 348 bp
Strand : -
Note : -

DNA sequence :
ATGATTCCGGTCGCAGCGAGTGCTCGGATCTGGATTGCTACCGGCCATACTGACATGAGGAAAGGCATGAATGGTCTGGC
GTTGCTGGTGCAGGAAGGCCTTGGCCGTGATCCGTTCGCGGGTGACGTCTTCGTGTTCCGCGGTCGAGCAGGTTCTTTGA
TCAAAGCCTTATGGCATGACGGGATCGGACTATCGCTGTACGCCAAGCGTCTGGACCGCGGTCGCTTCGTGTGGCCGGTG
ACGGTGGATGGCGTGGTGGCGCTGAGTGCTGCACAGATGAGTTATCTGCTGGAAGCGATCGACTGGCGCAATCCGCAACA
TACCTGGCGACCGCAGAGCGCTGGATAG

Protein sequence :
MIPVAASARIWIATGHTDMRKGMNGLALLVQEGLGRDPFAGDVFVFRGRAGSLIKALWHDGIGLSLYAKRLDRGRFVWPV
TVDGVVALSAAQMSYLLEAIDWRNPQHTWRPQSAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-26 59
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 5e-29 59
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-29 59
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-28 58
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-28 58
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-28 58
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 3e-21 56
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-26 56
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-26 56
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-26 56
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-26 56
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-26 56
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-26 56
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-26 56
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-26 56
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-25 56
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-26 56
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-26 56
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-25 56
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-26 54
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 9e-26 47
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 9e-26 47
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 5e-25 45
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 5e-25 45
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-25 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nham_2996 YP_578212.1 IS66 Orf2 like VFG1665 Protein 5e-29 58
Nham_2996 YP_578212.1 IS66 Orf2 like VFG1517 Protein 1e-21 56
Nham_2996 YP_578212.1 IS66 Orf2 like VFG1698 Protein 6e-27 56
Nham_2996 YP_578212.1 IS66 Orf2 like VFG1709 Protein 5e-27 56
Nham_2996 YP_578212.1 IS66 Orf2 like VFG0792 Protein 5e-27 56
Nham_2996 YP_578212.1 IS66 Orf2 like VFG1052 Protein 1e-26 54
Nham_2996 YP_578212.1 IS66 Orf2 like VFG1737 Protein 3e-26 45