Name : rpmJ (Nham_1214) Accession : YP_576502.1 Strain : Nitrobacter hamburgensis X14 Genome accession: NC_007964 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L36 Function : - COG functional category : - COG ID : - EC number : - Position : 1371524 - 1371649 bp Length : 126 bp Strand : + Note : smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc io DNA sequence : ATGAAGGTCCGTAACTCGCTGAAATCGCTGCGTGCGCGTCATCGGGACAACCGTCTGGTCCGCCGCAAGGGCCGGGTCTA TGTGATCAACAAGACCCAGCGCCGTTTCAAGGCTCGTCAGGGCTGA Protein sequence : MKVRNSLKSLRARHRDNRLVRRKGRVYVINKTQRRFKARQG |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
rpmJ | YP_001800879.1 | 50S ribosomal protein L36 | Not tested | Not named | Protein | 5e-06 | 61 |