Gene Information

Name : Nham_4417 (Nham_4417)
Accession : YP_571833.1
Strain :
Genome accession: NC_007960
Putative virulence/resistance : Resistance
Product : mercuric transport protein periplasmic protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 64853 - 65137 bp
Length : 285 bp
Strand : -
Note : -

DNA sequence :
ATGACGAAGTTCCCCACTTCGCTCGCGCTCGGGTTGCTTATCATTTCCTCCGGCGGGGCAATGGCGGAGCAACGAACCGT
CACCCTGGCGGTGGACAACATGTACTGCGAAGCCTGTCCTTACATGATCAAGAAGACCATCGAGAAGGTTTCCGGCGTCT
CAAAAGTCACCGTTTCGTTTAAGGAAAAAACCGCAATCGTTGTGTTCGATGATGCGCGGGCAGAGGTCAACGATCTGACG
AATGCGACGACCAGCGCCGGCTTTCCTTCGGCGCCGAAACGCTGA

Protein sequence :
MTKFPTSLALGLLIISSGGAMAEQRTVTLAVDNMYCEACPYMIKKTIEKVSGVSKVTVSFKEKTAIVVFDDARAEVNDLT
NATTSAGFPSAPKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ABQ57373.1 MerP Not tested SGI1 Protein 2e-14 55
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 2e-14 55
merP AFG30122.1 MerP Not tested PAGI-2 Protein 2e-14 55
merP AGK07023.1 MerP Not tested SGI1 Protein 2e-14 55
merP AGK07081.1 MerP Not tested SGI1 Protein 2e-14 55
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 3e-14 55
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 6e-14 52
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 8e-14 52
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 1e-13 48
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 5e-13 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nham_4417 YP_571833.1 mercuric transport protein periplasmic protein BAC0679 Protein 2e-15 56
Nham_4417 YP_571833.1 mercuric transport protein periplasmic protein BAC0231 Protein 6e-15 55
Nham_4417 YP_571833.1 mercuric transport protein periplasmic protein BAC0678 Protein 7e-15 55
Nham_4417 YP_571833.1 mercuric transport protein periplasmic protein BAC0675 Protein 4e-14 53