Gene Information

Name : Nham_4211 (Nham_4211)
Accession : YP_571662.1
Strain :
Genome accession: NC_007959
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 168526 - 168855 bp
Length : 330 bp
Strand : +
Note : -

DNA sequence :
ATGACAAGCAAGACGACGAACAAGTTTTCACCGGAGGTTCGGGCCCGAGCGGTTCGGATGGTTGTGGATCACGGCAGCGA
GTATCCGTCTCGCTGGGCTGCGATTGAGGCGATAGCCCCCAAGATCGGCTGTTCCGGCCATACCCTGCTGGAATGGGTGA
AGAAGGTGGAGATCGACAGGGGCAAGCGAGCAGGTGTTCCGACGGACGTGGCGGAGAAACTGAAGGCGCTCGAGCGGGAG
AACCGCGAGCTTCGGCAGGCCAATGAGATCTTGCGCAAGGCGAGCGCTTATTTTGCGACGGCGGAGCTCGACCGCCGGTC
CAAGCCATGA

Protein sequence :
MTSKTTNKFSPEVRARAVRMVVDHGSEYPSRWAAIEAIAPKIGCSGHTLLEWVKKVEIDRGKRAGVPTDVAEKLKALERE
NRELRQANEILRKASAYFATAELDRRSKP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 1e-20 60
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 5e-21 60
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 3e-23 60
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 5e-21 60
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 3e-23 60
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 5e-21 60
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 3e-21 60
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 3e-23 60
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 5e-21 60
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 3e-21 60
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 3e-23 60
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 2e-19 59
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 1e-19 59
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 3e-23 59
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 3e-23 59
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 3e-23 59
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 4e-23 59
unnamed AAF09023.1 unknown Not tested SHI-O Protein 5e-21 59
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 5e-21 59
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 3e-23 59
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 1e-21 58
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 2e-19 58
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 1e-21 58
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 6e-20 58
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 1e-21 58
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 6e-19 57
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 8e-19 57
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 8e-19 57
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 8e-19 57
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 6e-19 57

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nham_4211 YP_571662.1 transposase IS3/IS911 VFG1603 Protein 6e-21 60
Nham_4211 YP_571662.1 transposase IS3/IS911 VFG0643 Protein 1e-21 60
Nham_4211 YP_571662.1 transposase IS3/IS911 VFG0606 Protein 2e-20 58
Nham_4211 YP_571662.1 transposase IS3/IS911 VFG1717 Protein 2e-19 57