Gene Information

Name : RPD_1997 (RPD_1997)
Accession : YP_569133.1
Strain : Rhodopseudomonas palustris BisB5
Genome accession: NC_007958
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2233957 - 2234631 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
GTGCGGCTGCTCGTCGTCGAAGATGATCCCGATCTCAACCGCCAGCTCACCACCGCGTTGACCGACGCCGGCTATGTGGT
GGACCGCGCCTTCGACGGCGAGGAAGGGCATTTCCTCGGCGATACCGAACCCTATGATGCGGTGGTGCTGGATATCGGCC
TGCCGAAGATGGACGGCATTTCCGTGCTGGAGGCTTGGCGGCGCAATGCCCGCGCGATGCCGGTGCTGATCCTCACCGCG
CGCGACCGCTGGAGCGACAAGGTGCAGGGCTTCGACGCCGGCGCCGACGATTATGTCGCCAAGCCGTTCCACCTCGAAGA
GGTGCTGGCGCGGATCCGCGCGCTGCTGCGCCGGAGCGCCGGCCACGCCCAGTCCGAACTGACCTGCGGCCCGGTGGCGC
TCGACACCCGCACCGGCCGCGTCAGCGTCCGCGGCCATCCGGTCAAGCTGACCTCGCACGAGTACCGGCTGCTGGCCTAT
CTGATGCACCATTCCGGCCGGGTGGTGTCGCGCACCGAACTGGTCGAGCATCTCTACGACCAGGATTTCGACCGCGACAG
CAACACCATCGAGGTGTTCGTCGGCCGCATCCGCAAGAAGCTCGACGTCGATATCATCCAGACCGTGCGCGGCCTCGGCT
ATCTGCTGACGCCGCCGCCGGCCGACGCCCATTAG

Protein sequence :
MRLLVVEDDPDLNRQLTTALTDAGYVVDRAFDGEEGHFLGDTEPYDAVVLDIGLPKMDGISVLEAWRRNARAMPVLILTA
RDRWSDKVQGFDAGADDYVAKPFHLEEVLARIRALLRRSAGHAQSELTCGPVALDTRTGRVSVRGHPVKLTSHEYRLLAY
LMHHSGRVVSRTELVEHLYDQDFDRDSNTIEVFVGRIRKKLDVDIIQTVRGLGYLLTPPPADAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-26 41
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPD_1997 YP_569133.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 4e-41 49
RPD_1997 YP_569133.1 winged helix family two component transcriptional regulator CP000647.1.gene1136. Protein 2e-36 46
RPD_1997 YP_569133.1 winged helix family two component transcriptional regulator BAC0530 Protein 2e-36 46
RPD_1997 YP_569133.1 winged helix family two component transcriptional regulator CP001138.1.gene1939. Protein 7e-36 45
RPD_1997 YP_569133.1 winged helix family two component transcriptional regulator CP004022.1.gene1005. Protein 2e-38 45
RPD_1997 YP_569133.1 winged helix family two component transcriptional regulator CP001918.1.gene2526. Protein 6e-35 44
RPD_1997 YP_569133.1 winged helix family two component transcriptional regulator NC_002695.1.913289.p Protein 3e-35 44
RPD_1997 YP_569133.1 winged helix family two component transcriptional regulator CP000034.1.gene2022. Protein 8e-36 44
RPD_1997 YP_569133.1 winged helix family two component transcriptional regulator BAC0487 Protein 2e-29 44
RPD_1997 YP_569133.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-26 41
RPD_1997 YP_569133.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-30 41
RPD_1997 YP_569133.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPD_1997 YP_569133.1 winged helix family two component transcriptional regulator VFG0475 Protein 6e-36 45
RPD_1997 YP_569133.1 winged helix family two component transcriptional regulator VFG0473 Protein 7e-28 42
RPD_1997 YP_569133.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-26 41
RPD_1997 YP_569133.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-27 41