Gene Information

Name : Bxe_C1381 (Bxe_C1381)
Accession : YP_556579.1
Strain :
Genome accession: NC_007953
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1458128 - 1458802 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence : 
ATGCGAATACTGGTCATCGAAGACGAAGCGAAAACAGGCGAATACCTGCTCAACGGTCTGACCGAGGCGGGTTATGTCGT
CGACGTCGCCGCCAATGGCATCGACGGGCTGCATCTGGCGAACGAAATGCGCTACGACCTGATTCTGCTCGACGTCATGA
TGCCGGAGATGGACGGCTGGAGCGTCATGAAAAAGCTCGGTGCCCGCCTCGATACGCCGGTCCTGTTTCTCAGCGCGCGC
GGCACGCTCGAAGACCGGCTCAAGGGCCTCGATCTCGGCGCCGACGATTACCTCGTCAAGCCGTTTTCGTTTGCGGAGCT
GCTCGCCCGCATCCGCATCATCCTGCGCCGCGGGCAGCCGCAAAAACAGGAAGAGCGGCTGGAAGTCGGTGATCTGCACA
TCGACGTGCCGAAACGGCGGGTCGAGCGTGGCGGCACGCGCATAACCCTCACCAACAAGGAATTCAATCTGCTGCTGTTC
TTCGTGCAGCATCAAGGCCAGGTCCTGTCCCGCGCGCTGATTGCATCGCGCGTATGGGACATGAATTTCGACAGCGACAG
CAATGTGGTCGACGTCGCCGTGCGGCGGCTCAGACAGAAAATCGACGAACCCTTCGAAGTGCGCCTGATTCATACCGTAC
ACGGCGTAGGCTACCGCTGCGAGCACGAAGCATGA

Protein sequence : 
MRILVIEDEAKTGEYLLNGLTEAGYVVDVAANGIDGLHLANEMRYDLILLDVMMPEMDGWSVMKKLGARLDTPVLFLSAR
GTLEDRLKGLDLGADDYLVKPFSFAELLARIRIILRRGQPQKQEERLEVGDLHIDVPKRRVERGGTRITLTNKEFNLLLF
FVQHQGQVLSRALIASRVWDMNFDSDSNVVDVAVRRLRQKIDEPFEVRLIHTVHGVGYRCEHEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-51 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-50 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_C1381 YP_556579.1 two component heavy metal response transcriptional regulator BAC0125 Protein 9e-61 62
Bxe_C1381 YP_556579.1 two component heavy metal response transcriptional regulator BAC0111 Protein 4e-61 62
Bxe_C1381 YP_556579.1 two component heavy metal response transcriptional regulator BAC0083 Protein 8e-57 58
Bxe_C1381 YP_556579.1 two component heavy metal response transcriptional regulator BAC0638 Protein 5e-51 58
Bxe_C1381 YP_556579.1 two component heavy metal response transcriptional regulator BAC0347 Protein 1e-54 57
Bxe_C1381 YP_556579.1 two component heavy metal response transcriptional regulator BAC0197 Protein 7e-56 57
Bxe_C1381 YP_556579.1 two component heavy metal response transcriptional regulator BAC0308 Protein 2e-50 55
Bxe_C1381 YP_556579.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 7e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_C1381 YP_556579.1 two component heavy metal response transcriptional regulator VFG0596 Protein 3e-51 55
Bxe_C1381 YP_556579.1 two component heavy metal response transcriptional regulator VFG1390 Protein 5e-34 44
Bxe_C1381 YP_556579.1 two component heavy metal response transcriptional regulator VFG1386 Protein 6e-35 44
Bxe_C1381 YP_556579.1 two component heavy metal response transcriptional regulator VFG1389 Protein 3e-30 44