Gene Information

Name : Bxe_C1217 (Bxe_C1217)
Accession : YP_556427.1
Strain :
Genome accession: NC_007953
Putative virulence/resistance : Resistance
Product : putative transcriptional regulator MerR
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1269863 - 1270297 bp
Length : 435 bp
Strand : +
Note : -

DNA sequence :
ATGGAAAACAATTTGGAAAATCTGACCATCGGCGTTTTCGCCAAGGCGGCCGGGGTCAACGTAGAGACCATCCGGTTCTA
TCAGCGCAAGGGCTTGTTGCCGGAGCCGGACAAGCCTTACGGCAGCATCCGCCGCTATGGCGAGGCGGATGTAACGCGGG
TGCGGTTCGTGAAATCAGCCCAGCGGCTGGGCTTCAGTCTGGATGAAATAGCCGAACTGCTGCGGCTGGAGGATGGCACC
CATTGCGAGGAAGCCAGTAGTCTGGCCGAGCACAAGCTCAAGGACGTGCGCGAAAAAATGACTGACTTGGCGCGTATGGA
GTCGGTGCTTTCCGAACTTGTGTGTGCCTGCCACCTGCGGCAGGGGAATGTTTCTTGCCCGCTGATTGCTTCACTGCAAG
GGAAGAAAGAACCGCGCAGTACCGACGCGGTGTAG

Protein sequence :
MENNLENLTIGVFAKAAGVNVETIRFYQRKGLLPEPDKPYGSIRRYGEADVTRVRFVKSAQRLGFSLDEIAELLRLEDGT
HCEEASSLAEHKLKDVREKMTDLARMESVLSELVCACHLRQGNVSCPLIASLQGKKEPRSTDAV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR ACK44535.1 MerR Not tested SGI1 Protein 8e-57 95
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 1e-56 95
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 8e-57 95
merR AFG30124.1 MerR Not tested PAGI-2 Protein 8e-57 95
merR AGK07025.1 MerR Not tested SGI1 Protein 4e-56 94
merR AGK07083.1 MerR Not tested SGI1 Protein 4e-56 94
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 9e-57 94
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-56 94
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 6e-49 78
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 1e-45 73
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 4e-27 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_C1217 YP_556427.1 putative transcriptional regulator MerR BAC0687 Protein 2e-57 97
Bxe_C1217 YP_556427.1 putative transcriptional regulator MerR BAC0232 Protein 2e-57 97
Bxe_C1217 YP_556427.1 putative transcriptional regulator MerR BAC0683 Protein 5e-58 95
Bxe_C1217 YP_556427.1 putative transcriptional regulator MerR BAC0684 Protein 2e-58 95
Bxe_C1217 YP_556427.1 putative transcriptional regulator MerR BAC0686 Protein 2e-60 94
Bxe_C1217 YP_556427.1 putative transcriptional regulator MerR BAC0688 Protein 4e-62 94
Bxe_C1217 YP_556427.1 putative transcriptional regulator MerR BAC0689 Protein 2e-54 92