Gene Information

Name : Bxe_C1215 (Bxe_C1215)
Accession : YP_556425.1
Strain :
Genome accession: NC_007953
Putative virulence/resistance : Resistance
Product : periplasmic mecuric binding protein, MerP
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1269152 - 1269427 bp
Length : 276 bp
Strand : -
Note : -

DNA sequence : 
ATGAAAAAGCTGTTTGCCTCCCTCGCTCTCGCCGCTTTCGTTGCCCCCGTGTTCGCCGCCACTCAGACCGTCACGCTGTC
CGTGCCTGGCATGACCTGCGCCTCTTGCCCGATCACTGTCAAGCACGCGCTTTCCAAGGTTGAGGGCGTGAGCAAGACCG
ACGTAAGTTTCGACAAGCGCCAGGCCGTCGTCACCTTCGACGATGCCAAGACCAACGTCCAGAAGTTGACCAAGGCGACC
GAGGACGCGGGCTATCCGTCCAGCCTCAAACGCTGA

Protein sequence : 
MKKLFASLALAAFVAPVFAATQTVTLSVPGMTCASCPITVKHALSKVEGVSKTDVSFDKRQAVVTFDDAKTNVQKLTKAT
EDAGYPSSLKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-25 100
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-25 100
merP AFG30122.1 MerP Not tested PAGI-2 Protein 9e-22 81
merP AGK07023.1 MerP Not tested SGI1 Protein 9e-22 81
merP AGK07081.1 MerP Not tested SGI1 Protein 9e-22 81
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 1e-21 81
merP ABQ57373.1 MerP Not tested SGI1 Protein 9e-22 81
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 9e-22 81
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 1e-21 78

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_C1215 YP_556425.1 periplasmic mecuric binding protein, MerP BAC0679 Protein 3e-22 84
Bxe_C1215 YP_556425.1 periplasmic mecuric binding protein, MerP BAC0678 Protein 8e-22 82
Bxe_C1215 YP_556425.1 periplasmic mecuric binding protein, MerP BAC0231 Protein 5e-22 81
Bxe_C1215 YP_556425.1 periplasmic mecuric binding protein, MerP BAC0675 Protein 3e-20 75
Bxe_C1215 YP_556425.1 periplasmic mecuric binding protein, MerP BAC0674 Protein 2e-15 60