Gene Information

Name : Bxe_C1212 (Bxe_C1212)
Accession : YP_556422.1
Strain :
Genome accession: NC_007953
Putative virulence/resistance : Resistance
Product : transcriptional regulator MerD
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1266592 - 1266957 bp
Length : 366 bp
Strand : -
Note : -

DNA sequence :
ATGAACGCCTACACGGTGTCCCGGTTGGCCTTTGATGCCGGGGTGAGTGTGCATATCGTGCGCGATTACCTGCTGCGTGG
ATTGCTGCGGCCAGTCGCCTGCACCACGGGTGGCTACGGCCTGTTCGATGACGCCGCCTTGCAGCGACTGTGCTTCGTGC
GGGCCGCCTTCGAGGCGGGCATCGGCCTCGGCGCATTGGCGCGGCTGTGCCGGGCGCTGGATGCGGCGAACTGCGATGAA
ACTGCCGCGCAGCTTGCTGTGCTGCGTCAGTTCGTCGAACGCCGGCGCGAAGCGTTGGCCAATCTGGAAGTGCAGTTGGC
CGCCATGCCGACCGCGCCGGCACAGCATGCGGAGAGTTTGCCATGA

Protein sequence :
MNAYTVSRLAFDAGVSVHIVRDYLLRGLLRPVACTTGGYGLFDDAALQRLCFVRAAFEAGIGLGALARLCRALDAANCDE
TAAQLAVLRQFVERRREALANLEVQLAAMPTAPAQHAESLP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merD ABQ57370.1 MerD Not tested SGI1 Protein 9e-34 91
merD AGK07020.1 MerD Not tested SGI1 Protein 4e-34 91
merD AGK07078.1 MerD Not tested SGI1 Protein 4e-34 91
merD ACN81004.1 MerD Not tested AbaR5 Protein 4e-34 88
merD CAJ77059.1 Mercury operon coregulator protein Not tested AbaR1 Protein 7e-34 88
merD AET25396.1 MerD Not tested PAGI-2(C) Protein 1e-27 81
merD AFG30119.1 MerD Not tested PAGI-2 Protein 1e-27 81
merD YP_006098386.1 MerR family transcriptional regulator Not tested Tn2411 Protein 2e-27 81
merD ACF06181.1 mercuric resistance protein Not tested Tn5036-like Protein 1e-27 81

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_C1212 YP_556422.1 transcriptional regulator MerD BAC0667 Protein 4e-40 99
Bxe_C1212 YP_556422.1 transcriptional regulator MerD BAC0669 Protein 8e-39 93
Bxe_C1212 YP_556422.1 transcriptional regulator MerD BAC0668 Protein 2e-34 91
Bxe_C1212 YP_556422.1 transcriptional regulator MerD BAC0666 Protein 3e-34 91
Bxe_C1212 YP_556422.1 transcriptional regulator MerD BAC0227 Protein 4e-34 91
Bxe_C1212 YP_556422.1 transcriptional regulator MerD BAC0665 Protein 5e-35 90