Gene Information

Name : Bxe_B0708 (Bxe_B0708)
Accession : YP_554595.1
Strain :
Genome accession: NC_007952
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2579978 - 2580658 bp
Length : 681 bp
Strand : -
Note : -

DNA sequence : 
ATGCGGATTCTGTTAGTGGAAGACGAGCCGAAGACCGGCGCCTATCTTCGCAAAGGCCTCTCGGAGGCGGGATACGTCGT
GGATTGGGCCGAAGACGGCGTCACGGGTCAGCACCAGGCGGAAACGGAAGACTACGATCTGCTGATCCTCGACGTGATGC
TGCCGGGCCAGGACGGCTGGACGCTGCTGCACAATCTCCGCCGCACGCGCTCCACGCCCGTGCTGTTTCTCACCGCGCGC
GACGACGTGGGCGACCGCGTCAGAGGACTGGAGCTCGGCGCCGACGACTACCTTGCGAAGCCGTTCGACTTTGTCGAACT
GGTCGCACGCGTCAGGTCGATCCTCAGGCGCGGCAAGCCGCGTGAAACCATGTCGCTGAAAGTCGCCGATCTCGAACTGG
ATCTGACGCGGCGCAAAGCGACCCGCCAGGGCGACGTGATCCTGCTGACCGCCAAGGAGTTCACGCTGTTGTGGCTGCTC
ATGCGCAAGGAAGGGGAAATCCTGCCGCGCGCCACGATTGCGTCGCAGGTGTGGGACATGAACTTCAACAGCGATACGAA
CGTCGTGGATTCGGCAATCAGGAGGCTGCGCTCCAAGGTCGACGACGCCTACGAACCCAAGCTCATTCACACGGTGAGAG
GCATGGGATATGTGCTGGAAGTCAGGAGTGGCGGCAATTGA

Protein sequence : 
MRILLVEDEPKTGAYLRKGLSEAGYVVDWAEDGVTGQHQAETEDYDLLILDVMLPGQDGWTLLHNLRRTRSTPVLFLTAR
DDVGDRVRGLELGADDYLAKPFDFVELVARVRSILRRGKPRETMSLKVADLELDLTRRKATRQGDVILLTAKEFTLLWLL
MRKEGEILPRATIASQVWDMNFNSDTNVVDSAIRRLRSKVDDAYEPKLIHTVRGMGYVLEVRSGGN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-59 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-57 57

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator BAC0197 Protein 5e-93 85
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator BAC0125 Protein 6e-68 63
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator BAC0083 Protein 2e-65 61
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator BAC0111 Protein 1e-63 60
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-58 59
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator BAC0308 Protein 2e-62 59
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator BAC0347 Protein 6e-59 56
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 4e-36 43
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 4e-36 43
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 4e-36 43
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 4e-36 43
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 4e-36 43
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 4e-36 43
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 4e-36 43
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 4e-36 43
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 7e-33 41
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 7e-33 41
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 6e-33 41
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 6e-33 41
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 6e-33 41
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 6e-33 41
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 6e-33 41
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 6e-33 41
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 8e-33 41
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 6e-33 41
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 9e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator VFG0596 Protein 3e-59 58
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator VFG1390 Protein 8e-39 45
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator VFG1386 Protein 1e-34 42
Bxe_B0708 YP_554595.1 two component heavy metal response transcriptional regulator VFG1389 Protein 1e-30 42