Gene Information

Name : Bxe_A0237 (Bxe_A0237)
Accession : YP_560747.1
Strain :
Genome accession: NC_007951
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 4600035 - 4600433 bp
Length : 399 bp
Strand : +
Note : -

DNA sequence :
ATGCAGGAAATGACCATCGGACAGCTGGCCGAAGCGGCAGAGGTCAATGTCGAGACCGTGCGGTACTACCATCGCCGGGG
GTTGCTTCCGCTACCGCCGCGTCCGACCGGTGGCATTCGGCGCTATCCGGCAGATGTGCTGAGGAGACTGCGCTTCATCA
AGCGGTCGCAGTCCCTTGGCTTTTCACTGGATGAGGTGGAAGCGTTGCTGTCTCTGCACGACGGTCAGACGTGCAGGGCC
GCGCGCGCAATCGCCGAACACAGGCTCACCGATGTGCGCCAGCGCATGCAGGATTTGTCGAGGCTGGAGGCCGCTCTGGC
GACCCTGGTGCACCGCTGTTCGAACGTCGAAAGGAAAGATGTCGTGCCCGCTCATCGACACACTCATGGACGGGGATGA

Protein sequence :
MQEMTIGQLAEAAEVNVETVRYYHRRGLLPLPPRPTGGIRRYPADVLRRLRFIKRSQSLGFSLDEVEALLSLHDGQTCRA
ARAIAEHRLTDVRQRMQDLSRLEAALATLVHRCSNVERKDVVPAHRHTHGRG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 2e-20 56
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-20 55
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-20 55
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 9e-21 53
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 4e-20 52
merR ACK44535.1 MerR Not tested SGI1 Protein 3e-20 52
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 3e-20 52
merR AFG30124.1 MerR Not tested PAGI-2 Protein 3e-20 52
merR AGK07025.1 MerR Not tested SGI1 Protein 2e-20 52
merR AGK07083.1 MerR Not tested SGI1 Protein 2e-20 52
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-21 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_A0237 YP_560747.1 MerR family transcriptional regulator BAC0688 Protein 3e-21 55
Bxe_A0237 YP_560747.1 MerR family transcriptional regulator BAC0684 Protein 2e-21 55
Bxe_A0237 YP_560747.1 MerR family transcriptional regulator BAC0683 Protein 7e-21 54
Bxe_A0237 YP_560747.1 MerR family transcriptional regulator BAC0687 Protein 4e-21 54
Bxe_A0237 YP_560747.1 MerR family transcriptional regulator BAC0686 Protein 3e-21 54
Bxe_A0237 YP_560747.1 MerR family transcriptional regulator BAC0232 Protein 4e-21 54
Bxe_A0237 YP_560747.1 MerR family transcriptional regulator BAC0689 Protein 5e-19 54
Bxe_A0237 YP_560747.1 MerR family transcriptional regulator BAC0682 Protein 1e-14 42