Gene Information

Name : Bxe_A0239 (Bxe_A0239)
Accession : YP_560745.1
Strain :
Genome accession: NC_007951
Putative virulence/resistance : Resistance
Product : periplasmic mercuric ion binding protein MerP
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 4599323 - 4599607 bp
Length : 285 bp
Strand : -
Note : -

DNA sequence :
ATGAAGAAACTGGTTACAGTGTTCGCGATGGCGCTGACAGCGTCGACCGCCTTCGCTGAAGGCCTTCGCACGGTCACCCT
TGACGTCACAAACATGGATTGCGCGGTGTGTCCGATTACGGTTCGCAAAGCGATTGAGAAGGTACCGGGCGTGGCTACGG
CCAAGGTCGACTTCGCGACCAAACGCGCGGAGGTGATATTTGACCCAAAGCAGACTACGGTCGGCGCATTGACGAAGGCC
ACAGCTGACGCGGGCTATCCATCTCATCTCGAGAGGGAGCAATGA

Protein sequence :
MKKLVTVFAMALTASTAFAEGLRTVTLDVTNMDCAVCPITVRKAIEKVPGVATAKVDFATKRAEVIFDPKQTTVGALTKA
TADAGYPSHLEREQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 6e-14 56
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 9e-14 56
merP AFG30122.1 MerP Not tested PAGI-2 Protein 3e-13 55
merP AGK07023.1 MerP Not tested SGI1 Protein 3e-13 55
merP AGK07081.1 MerP Not tested SGI1 Protein 3e-13 55
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 4e-13 55
merP ABQ57373.1 MerP Not tested SGI1 Protein 3e-13 55
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 3e-13 55
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 3e-13 55
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 1e-12 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_A0239 YP_560745.1 periplasmic mercuric ion binding protein MerP BAC0679 Protein 8e-15 58
Bxe_A0239 YP_560745.1 periplasmic mercuric ion binding protein MerP BAC0678 Protein 2e-14 58
Bxe_A0239 YP_560745.1 periplasmic mercuric ion binding protein MerP BAC0675 Protein 3e-15 58
Bxe_A0239 YP_560745.1 periplasmic mercuric ion binding protein MerP BAC0231 Protein 2e-14 56
Bxe_A0239 YP_560745.1 periplasmic mercuric ion binding protein MerP BAC0674 Protein 7e-12 45