Gene Information

Name : Bxe_A4438 (Bxe_A4438)
Accession : YP_556615.1
Strain :
Genome accession: NC_007951
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 32344 - 32775 bp
Length : 432 bp
Strand : +
Note : -

DNA sequence :
ATGAAAATCGGTGAATTGGCGAAAATCGCCCATTGCACGACCGAAACCATCCGTTTCTACGAAAAAGAGAGCCTGTTGCC
GGAAGCGGAGCGCACCGGGGCCAATTACCGCAGTTACACGGCAAAGCACGTCGAACGGCTGCGTTTCATCCGTAATTGCC
GCGCGCTCGACATGACGCACGACGAAATTCGTGGGTTGCTGCGTCTGACCGACGCACCGGCCACCGGCTGCGGCGGCATC
AATGCCTTGATCGACGAGCACATCGCGCACGTCGACACCCGCATCGAAGAACTGAAGCAGCTGAAAGTGCAATTGACCAC
GCTGCGCGAGCAATGCCACGGCGAACAGGCCGTGGAAGACTGCGGCATCGTGCAAGGTCTCAACGAAATGGATGTGAGCG
CACCGCGTGCGCGGCATACGCATCTGGGTTGA

Protein sequence :
MKIGELAKIAHCTTETIRFYEKESLLPEAERTGANYRSYTAKHVERLRFIRNCRALDMTHDEIRGLLRLTDAPATGCGGI
NALIDEHIAHVDTRIEELKQLKVQLTTLREQCHGEQAVEDCGIVQGLNEMDVSAPRARHTHLG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 2e-32 52
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 2e-31 49
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 9e-32 49
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 9e-32 49
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 1e-31 49
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 3e-31 48
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 4e-31 48
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 2e-31 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_A4438 YP_556615.1 MerR family transcriptional regulator BAC0301 Protein 3e-33 60
Bxe_A4438 YP_556615.1 MerR family transcriptional regulator BAC0058 Protein 2e-39 58