|
Name : Bxe_A2502 (Bxe_A2502) Accession : YP_558523.1 Strain : Genome accession: NC_007951 Putative virulence/resistance : Resistance Product : quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2076 EC number : - Position : 2167673 - 2168011 bp Length : 339 bp Strand : + Note : Citation: Paulsen,I.T., Littlejohn,T.G.,Radstrom,P., Sundstrom,L., Skold,O., Swedberg,G. andSkurray, R.A.Antimicrob. Agents Chemother. 37 (4), 761-768(1993) DNA sequence : ATGCGGTTGCCCGCTTACGCATTGCTAGGCATCGCCATCGTGGCCGAAGTGATTGCAACCTCCGCGATGCGCGCATCGGA CGGTTTCTCGCGGATACTGCCTTCAGCGGTGGTGGTGCTCGGCTATGGCGTGGCGTTCTATTGCCTGTCGCTGACGCTCA GGAGTATTCCGGTCGGCATCGTCTATGCGGTATGGTCCGGCGCCGGCATCGTGCTGATCACGCTGGTCGCGGTGGTGTTG TACCGGCAGGTGCCCGACGTGCCGGCCATTATCGGCCTCGGGCTGATCATTGCCGGCGTCGCCGTGCTGAACATGTTCTC GAAGATGCAGGCGCACTGA Protein sequence : MRLPAYALLGIAIVAEVIATSAMRASDGFSRILPSAVVVLGYGVAFYCLSLTLRSIPVGIVYAVWSGAGIVLITLVAVVL YRQVPDVPAIIGLGLIIAGVAVLNMFSKMQAH |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| qacEdelta1 | AGK07100.1 | QacEdelta1 | Not tested | SGI1 | Protein | 4e-17 | 60 |
| qacEdelta1 | AGF34989.1 | QacEdelta1 | Not tested | SGI1 | Protein | 4e-17 | 60 |
| qacEdelta1 | CAJ77049.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 4e-17 | 60 |
| qacEdelta1 | YP_005797150.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 5e-17 | 60 |
| qacEdelta1 | AGK07109.1 | QacEdelta1 | Not tested | SGI1 | Protein | 4e-17 | 60 |
| qacEdelta1 | AGF35028.1 | QacEdelta1 | Not tested | SGI1 | Protein | 4e-17 | 60 |
| qacEdelta1 | CAJ77052.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 4e-17 | 60 |
| ebr | YP_006098377.1 | putative ethidium bromide resistance protein | Not tested | Tn2411 | Protein | 5e-17 | 60 |
| qacEdelta1 | AFV53123.1 | QacEdelta1 multidrug exporter | Not tested | AbGRI2-1 | Protein | 4e-17 | 60 |
| qacEdelta1 | AGF35063.1 | QacEdelta1 | Not tested | SGI1 | Protein | 4e-17 | 60 |
| qacEdelta1 | CAJ77088.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 4e-17 | 60 |
| qacEdelta1 | ACN81026.1 | QacEdelta1 | Not tested | AbaR5 | Protein | 5e-17 | 60 |
| qacEdelta1 | AGK36647.1 | QacEdelta1 | Not tested | AbaR26 | Protein | 4e-17 | 60 |
| qacEdelta1 | AGK06933.1 | QacEdelta1 | Not tested | SGI1 | Protein | 4e-17 | 60 |
| qacE-deltal | ACF06159.1 | quartenary ammonium compound resistance protein | Not tested | Tn5036-like | Protein | 4e-17 | 60 |
| qacEdelta1 | AAK02047.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 4e-17 | 60 |
| qacEdelta1 | AGK06970.1 | QacEdelta1 | Not tested | SGI1 | Protein | 4e-17 | 60 |
| qacE-delta1 | ACY75523.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 4e-17 | 60 |
| qacEdelta1 | AAK02056.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 4e-17 | 60 |
| qacEdelta1 | AGK06979.1 | QacEdelta1 | Not tested | SGI1 | Protein | 4e-17 | 60 |
| qacE-delta1 | ACY75532.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 4e-17 | 60 |
| qacEdelta1 | ABB48428.1 | QacEdelta1 | Not tested | SGI1 | Protein | 4e-17 | 60 |
| qacEdelta1 | AGK07016.1 | QacEdelta1 | Not tested | SGI1 | Protein | 4e-17 | 60 |
| qacE-delta1 | AET25389.1 | QacE-delta1 | Not tested | PAGI-2(C) | Protein | 4e-17 | 60 |
| qacEdelta1 | ABZ01839.1 | QacEdelta1 | Not tested | SGI2 | Protein | 4e-17 | 60 |
| ACICU_00227 | YP_001844886.1 | membrane transporter | Not tested | AbaR20 | Protein | 5e-17 | 60 |
| qacEdelta1 | AGK07074.1 | QacEdelta1 | Not tested | SGI1 | Protein | 4e-17 | 60 |
| qacE-delta1 | AFG30112.1 | QacE-delta1 | Not tested | PAGI-2 | Protein | 4e-17 | 60 |
| qacEdelta1 | CAJ77030.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 4e-17 | 60 |
| qacEdelta1 | YP_005797134.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 5e-17 | 60 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Bxe_A2502 | YP_558523.1 | quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE | BAC0322 | Protein | 1e-17 | 60 |
| Bxe_A2502 | YP_558523.1 | quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE | BAC0323 | Protein | 2e-17 | 60 |
| Bxe_A2502 | YP_558523.1 | quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE | BAC0377 | Protein | 2e-18 | 59 |
| Bxe_A2502 | YP_558523.1 | quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE | BAC0002 | Protein | 3e-17 | 59 |
| Bxe_A2502 | YP_558523.1 | quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE | NC_010410.6003348.p0 | Protein | 3e-17 | 59 |
| Bxe_A2502 | YP_558523.1 | quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE | CP001138.1.gene1489. | Protein | 4e-16 | 56 |
| Bxe_A2502 | YP_558523.1 | quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE | BAC0150 | Protein | 1e-11 | 47 |
| Bxe_A2502 | YP_558523.1 | quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE | NC_002695.1.913273.p | Protein | 1e-11 | 47 |
| Bxe_A2502 | YP_558523.1 | quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE | BAC0139 | Protein | 4e-14 | 46 |
| Bxe_A2502 | YP_558523.1 | quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE | BAC0477 | Protein | 5e-04 | 42 |
| Bxe_A2502 | YP_558523.1 | quaternary ammonium efflux pump, 4 TMS small multidrug resistance (SMR) family, GacE | BAC0329 | Protein | 1e-13 | 42 |
