Gene Information

Name : Bxe_A2960 (Bxe_A2960)
Accession : YP_558069.1
Strain :
Genome accession: NC_007951
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1650145 - 1650828 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
ATGCGTATCCTGATCGTCGAGGACGAAATCAAAACCGGCACGTACCTTCGAAAGGGATTGACCGAGGCGGGCTTTATCGT
CGACTGGGTGGCAGACGGCGTGACGGGCCAGCATCGCGCGCTGACGGAAGACTACGACCTGATCATCCTCGACGTCATGC
TGCCCGGCCAGGACGGCTGGACAGTGCTGAAAAACCTGCGCCGCACGCATTCGACCTCGGTGCTGCTGCTCACCGCGCGC
GACGAGGTGGACGACAAGGTGCGCGGCCTCGAAATGGGCGGCGACGACTATCTCGGCAAGCCGTTCGACTTTGCCGAGCT
GCTGGCCCGTGTCCGTTCCATCCTGCGACGCGGACAACCCCGCGACGCCGCCTCGCTGCAGGTGTCGAATCTCGTGCTCG
ATCTGACGCGCCGCAAGGCCACGCGCCAGGGCGACACGATCCTGCTCACGGCCAAGGAATTCGCGCTGCTGTGGCTGCTG
ATGCGTCGTCAGGGTGAAATCCTGCCTCGCTCGACGATCGCCTCGCAGGTGTGGGACATGAACTTCGACAGCGACACGAA
CGTCGTGGATGCCGCGATCCGGCGCCTGCGCGCGAAAGTCGACGACAACTACGAACCCAGGCTGATACACACCGTACGCG
GCATGGGCTACGTGCTGGAAGAGCGCCACGCGTTGCCGCCATGA

Protein sequence :
MRILIVEDEIKTGTYLRKGLTEAGFIVDWVADGVTGQHRALTEDYDLIILDVMLPGQDGWTVLKNLRRTHSTSVLLLTAR
DEVDDKVRGLEMGGDDYLGKPFDFAELLARVRSILRRGQPRDAASLQVSNLVLDLTRRKATRQGDTILLTAKEFALLWLL
MRRQGEILPRSTIASQVWDMNFDSDTNVVDAAIRRLRAKVDDNYEPRLIHTVRGMGYVLEERHALPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-60 59
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-58 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator BAC0197 Protein 7e-88 80
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator BAC0083 Protein 2e-66 62
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator BAC0111 Protein 1e-65 60
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator BAC0125 Protein 2e-65 60
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator BAC0638 Protein 4e-57 59
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator BAC0308 Protein 2e-61 58
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator BAC0347 Protein 3e-60 55
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 7e-39 43
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 7e-39 43
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 7e-39 43
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 7e-39 43
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 7e-39 43
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 7e-39 43
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 7e-39 43
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 7e-39 43
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 4e-34 41
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator AE016830.1.gene1681. Protein 4e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator VFG0596 Protein 3e-60 59
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator VFG1390 Protein 1e-37 43
Bxe_A2960 YP_558069.1 two component heavy metal response transcriptional regulator VFG1389 Protein 2e-31 42