Gene Information

Name : Bpro_5536 (Bpro_5536)
Accession : YP_552284.1
Strain :
Genome accession: NC_007950
Putative virulence/resistance : Unknown
Product : IS66 Orf2 like
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 293627 - 293974 bp
Length : 348 bp
Strand : -
Note : -

DNA sequence :
GTGATCGGCTTGCCGTCGGGCACGCGGATTTGGCTGGCTGGCGGACTGACCGACATGCGCCGTGGCTTTGATGGCCTGGC
CGCCCTTGCGCAAGGCGCGTTGGAGCAGGATCCGTTTAGCGGCCATGTCTTTGTGTTTCGGGGTCGGCGCGGTGACATCG
TAAAGTTGCTATGGTGGGATGGACAGGGGCTGTGCCTGTTTGCCAAGAGGCTTGAGAAAGGCCGCTTCATATGGCCACAG
GCCTTGAGCGGTTCGGTGGTTCTGACACCAGCGCAACTGTCCATGCTGCTCGAAGGAATTGACTGGCGAATGCCGGTTCG
CACGACGCAACCGACGCGTGCGATGTAG

Protein sequence :
MIGLPSGTRIWLAGGLTDMRRGFDGLAALAQGALEQDPFSGHVFVFRGRRGDIVKLLWWDGQGLCLFAKRLEKGRFIWPQ
ALSGSVVLTPAQLSMLLEGIDWRMPVRTTQPTRAM

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-29 70
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-29 70
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-29 70
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-29 70
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 8e-30 70
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-29 70
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 8e-30 70
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-29 70
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-29 70
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-29 70
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-28 69
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-28 69
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-22 68
unnamed AAL08461.1 unknown Not tested SRL Protein 5e-29 68
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-30 67
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 4e-30 66
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 4e-30 66
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 8e-32 65
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 8e-32 65
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 7e-32 64
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-28 61
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-29 61
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-28 61
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-29 61
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-29 60

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpro_5536 YP_552284.1 IS66 Orf2 like VFG1709 Protein 9e-30 70
Bpro_5536 YP_552284.1 IS66 Orf2 like VFG1698 Protein 2e-30 70
Bpro_5536 YP_552284.1 IS66 Orf2 like VFG0792 Protein 9e-30 70
Bpro_5536 YP_552284.1 IS66 Orf2 like VFG1517 Protein 9e-23 68
Bpro_5536 YP_552284.1 IS66 Orf2 like VFG1052 Protein 2e-29 68
Bpro_5536 YP_552284.1 IS66 Orf2 like VFG1665 Protein 3e-32 64
Bpro_5536 YP_552284.1 IS66 Orf2 like VFG1737 Protein 7e-30 60