Gene Information

Name : Bpro_0543 (Bpro_0543)
Accession : YP_547401.1
Strain : Polaromonas sp. JS666
Genome accession: NC_007948
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 541183 - 541908 bp
Length : 726 bp
Strand : +
Note : -

DNA sequence :
ATGGAATCCGCTAAGCGCGTTTTGATCGTCGAGGACGATACCCACATTGCGGAACTGCTCCGTATGCATCTTCAGGACGA
GGGCTACGCCGTCCAGCATGCGGCAGATGGGAATGCCGGCCTGCGCGAGCTCGAACGCGGCAGTTGGGATGCGCTCGTGC
TCGACCTCATGCTGCCAGGCGTCGATGGTCTCGAAATCTGTCGCCGAGCCCGAGCCATGACGCGCTATACGCCGATCATC
ATCACCAGCGCGCGCTCGAGCGAGGTGCATCGCATCCTGGGGCTTGAACTCGGTGCCGACGACTACCTGGCCAAGCCGTT
CTCCGTACTGGAACTGGTGGCGCGGGTTCGAGCGCTGCTGCGGCGTACCGACGCGCTCGCGCGGAACGCGCGCATGGAGT
CGGGCCTGCTCGAACTTGGAAACCTGCGTGTCGATCCCGTGGCACGGGAGGTGCAAGTGGAAGGTAAGTCCGTCGAGCTG
ACGCCACGCGAGTTTGACCTGCTTTACTTTTTCGCGCGGCACCCCGGAAAGGTGTTTTCGCGGCTGAATCTGCTCAATCA
AGTATGGGGCTACCAGCACGACGGGTATGAACACACGGTCAATACCCACATCAATCGGCTTCGCATGAAGGTCGAGGCGG
ATCCAACGGAGCCGCGGCGTATCCTCACGGTGTGGGGGCGCGGCTACAAGTTGGCGATATCGGCCATGGAGGAGAGCGGC
GAATGA

Protein sequence :
MESAKRVLIVEDDTHIAELLRMHLQDEGYAVQHAADGNAGLRELERGSWDALVLDLMLPGVDGLEICRRARAMTRYTPII
ITSARSSEVHRILGLELGADDYLAKPFSVLELVARVRALLRRTDALARNARMESGLLELGNLRVDPVAREVQVEGKSVEL
TPREFDLLYFFARHPGKVFSRLNLLNQVWGYQHDGYEHTVNTHINRLRMKVEADPTEPRRILTVWGRGYKLAISAMEESG
E

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-64 60
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-64 60

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpro_0543 YP_547401.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-36 46
Bpro_0543 YP_547401.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-33 43
Bpro_0543 YP_547401.1 two component transcriptional regulator NC_012469.1.7686381. Protein 3e-36 43
Bpro_0543 YP_547401.1 two component transcriptional regulator HE999704.1.gene1528. Protein 4e-31 42
Bpro_0543 YP_547401.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-36 42
Bpro_0543 YP_547401.1 two component transcriptional regulator AE016830.1.gene1681. Protein 3e-36 42
Bpro_0543 YP_547401.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-37 41
Bpro_0543 YP_547401.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-37 41
Bpro_0543 YP_547401.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 6e-37 41
Bpro_0543 YP_547401.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-37 41
Bpro_0543 YP_547401.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-37 41
Bpro_0543 YP_547401.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-37 41
Bpro_0543 YP_547401.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-37 41
Bpro_0543 YP_547401.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-37 41
Bpro_0543 YP_547401.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-37 41
Bpro_0543 YP_547401.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-37 41
Bpro_0543 YP_547401.1 two component transcriptional regulator NC_012469.1.7685629. Protein 4e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpro_0543 YP_547401.1 two component transcriptional regulator VFG1563 Protein 2e-64 60
Bpro_0543 YP_547401.1 two component transcriptional regulator VFG1702 Protein 4e-65 60
Bpro_0543 YP_547401.1 two component transcriptional regulator VFG1389 Protein 2e-23 45
Bpro_0543 YP_547401.1 two component transcriptional regulator VFG1390 Protein 9e-31 43