Gene Information

Name : Bpro_4798 (Bpro_4798)
Accession : YP_551575.1
Strain : Polaromonas sp. JS666
Genome accession: NC_007948
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 5081801 - 5082211 bp
Length : 411 bp
Strand : +
Note : -

DNA sequence :
ATGCAAATACCATCGCAAATTCTCACCATCGGCGCGCTGGCTGCCGAGGCAGGCGTCAATGTCGAAACCATTCGTTTTTA
CCAGCGCAGGAAGCTGCTGCCCGAGCCTGAGCGCCCTTTCGGCGGCATTCGCCGCTATGGCCCAGCAGAGGTATCTCGTC
TGCGCTTCATCAAGGCGGCCCAGCGCATCGGATTCACGCTGGACGAGATCGCGCAGTTGCTGCAGCTTGAAGACGGCACA
CATTGCTCGCAGGCCAGAACCATCGCAGAGCACAAGCTCACCGATGTCCGCCATCGGCTCGAAGATCTGCAGCGTATCGA
AACAGCCCTGGCGCAACTCGTCAAACGTTGCGCCGCCGGCCGGGGCAAGGTCACCTGCCCGCTGATTGCGTCTTTGCAGG
AGACGGCCTGA

Protein sequence :
MQIPSQILTIGALAAEAGVNVETIRFYQRRKLLPEPERPFGGIRRYGPAEVSRLRFIKAAQRIGFTLDEIAQLLQLEDGT
HCSQARTIAEHKLTDVRHRLEDLQRIETALAQLVKRCAAGRGKVTCPLIASLQETA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 4e-44 64
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 3e-43 64
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 2e-43 64
merR ACK44535.1 MerR Not tested SGI1 Protein 4e-41 62
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 4e-41 62
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 5e-41 62
merR AFG30124.1 MerR Not tested PAGI-2 Protein 4e-41 62
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 5e-40 61
merR AGK07025.1 MerR Not tested SGI1 Protein 2e-40 61
merR AGK07083.1 MerR Not tested SGI1 Protein 2e-40 61
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 3e-29 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpro_4798 YP_551575.1 MerR family transcriptional regulator BAC0688 Protein 8e-43 65
Bpro_4798 YP_551575.1 MerR family transcriptional regulator BAC0686 Protein 3e-42 64
Bpro_4798 YP_551575.1 MerR family transcriptional regulator BAC0687 Protein 5e-42 63
Bpro_4798 YP_551575.1 MerR family transcriptional regulator BAC0232 Protein 5e-42 63
Bpro_4798 YP_551575.1 MerR family transcriptional regulator BAC0684 Protein 1e-42 61
Bpro_4798 YP_551575.1 MerR family transcriptional regulator BAC0689 Protein 1e-40 61
Bpro_4798 YP_551575.1 MerR family transcriptional regulator BAC0683 Protein 7e-42 60
Bpro_4798 YP_551575.1 MerR family transcriptional regulator BAC0682 Protein 2e-22 44