Gene Information

Name : Bpro_2232 (Bpro_2232)
Accession : YP_549056.1
Strain : Polaromonas sp. JS666
Genome accession: NC_007948
Putative virulence/resistance : Resistance
Product : putative transcriptional regulator MerR
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 2321822 - 2322256 bp
Length : 435 bp
Strand : +
Note : -

DNA sequence :
ATGCAAAATATTTTTGGGAATTTGACCATTGGCGTTTTTGCCAAGGCGGCCGGGGTCAACGTGGAGACCATCCGGTTCTA
TCAGCGCAAGGGCCTGCTGCCGGAGCCAGACAAGCCTTACGGCAGCATTCGCCGGTATGGCGAGGCGGATGTAACGCGGG
TGCGGTTTGTGAAATCGGCCCAGCGACTGGGCTTCAGCCTGGACGAGATCGCCGAATTGCTCAGATTGGAGGATGGCACC
CACTGCCGCGAAGCCAGTAACCTGGCCGAGCACAAGCTCCAGGACGTGCGCGAAAAGATGGCTGACCTGGCGCGCATGGA
AACCGTGCTATCCAAGCTTGTGTGCGCCTGCCATGCACGGAAGGGGAACGTTTCCTGTCCGCTGATTGCGTCGCTCCAAG
GGGAGAAAGAAACTTCCAGCTCCGGGGCGAAATAG

Protein sequence :
MQNIFGNLTIGVFAKAAGVNVETIRFYQRKGLLPEPDKPYGSIRRYGEADVTRVRFVKSAQRLGFSLDEIAELLRLEDGT
HCREASNLAEHKLQDVREKMADLARMETVLSKLVCACHARKGNVSCPLIASLQGEKETSSSGAK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-56 89
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-56 89
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-55 88
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-55 88
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 3e-55 88
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-55 88
merR AGK07025.1 MerR Not tested SGI1 Protein 9e-55 87
merR AGK07083.1 MerR Not tested SGI1 Protein 9e-55 87
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 4e-48 78
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 4e-45 73
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 1e-27 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bpro_2232 YP_549056.1 putative transcriptional regulator MerR BAC0686 Protein 1e-56 89
Bpro_2232 YP_549056.1 putative transcriptional regulator MerR BAC0688 Protein 1e-57 88
Bpro_2232 YP_549056.1 putative transcriptional regulator MerR BAC0232 Protein 1e-55 88
Bpro_2232 YP_549056.1 putative transcriptional regulator MerR BAC0687 Protein 1e-55 88
Bpro_2232 YP_549056.1 putative transcriptional regulator MerR BAC0689 Protein 2e-54 87
Bpro_2232 YP_549056.1 putative transcriptional regulator MerR BAC0684 Protein 6e-57 86
Bpro_2232 YP_549056.1 putative transcriptional regulator MerR BAC0683 Protein 9e-57 85