Gene Information

Name : LSL_0522 (LSL_0522)
Accession : YP_535414.1
Strain : Lactobacillus salivarius UCC118
Genome accession: NC_007929
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 567551 - 568237 bp
Length : 687 bp
Strand : +
Note : COG0745 [TK] Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAGCAGAATTTTAATAATTGAGGACGAAAAAAATTTATCTCGTTTTGTTGAACTTGAGTTACAACACGAAGAATATGA
GACTGAAGTATGTAAAAATGGACGACAAGGTTTAGAATTGGCACTGGACGAAGATTGGGATGCAATTTTACTAGATTTAA
TGTTACCTGAATTAAATGGTTTAGATATTTGCCGTCGTGTTCGTCAAGTGAAGAATACACCAATTATCATGATGACCGCA
AGAGATTCAGTTATCGACAGAGTTTCAGGTCTAGATCATGGAGCAGATGACTATATTGTAAAACCATTTGCTATTGAAGA
ATTACTAGCAAGATTAAGAGCCGTTTTGCGTCGTGTGGAGCTAGAAAATGAACAAAACGGAAATAAACAAACAACACTAA
CATATCGCGACTTAACTATTGAAAAGGAAAATAGAGTTGTAAGACGTGGAGATGAAATCATAGAGTTAACTAAGAGAGAG
TATGAACTACTATTAACGTTGATGGAAAATATAAATGTTGTTTTAGCTAGAGATACACTTTTGAAGAAAGTATGGGGATA
TGAAACACAAATAGAAACAAATGTTGTGGATGTTTATATCCGTTATTTACGTAATAAGATTGATCGTCCTGGAGAAGACA
GCTATATCCAAACAGTTCGTGGTACTGGATATGTAATGCGTTCCTAA

Protein sequence :
MSRILIIEDEKNLSRFVELELQHEEYETEVCKNGRQGLELALDEDWDAILLDLMLPELNGLDICRRVRQVKNTPIIMMTA
RDSVIDRVSGLDHGADDYIVKPFAIEELLARLRAVLRRVELENEQNGNKQTTLTYRDLTIEKENRVVRRGDEIIELTKRE
YELLLTLMENINVVLARDTLLKKVWGYETQIETNVVDVYIRYLRNKIDRPGEDSYIQTVRGTGYVMRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-25 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-25 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LSL_0522 YP_535414.1 two-component response regulator HE999704.1.gene1528. Protein 2e-75 79
LSL_0522 YP_535414.1 two-component response regulator NC_002951.3238224.p0 Protein 5e-41 53
LSL_0522 YP_535414.1 two-component response regulator NC_007793.3914065.p0 Protein 5e-41 53
LSL_0522 YP_535414.1 two-component response regulator NC_002758.1121390.p0 Protein 5e-41 53
LSL_0522 YP_535414.1 two-component response regulator NC_010079.5776364.p0 Protein 5e-41 53
LSL_0522 YP_535414.1 two-component response regulator NC_002952.2859858.p0 Protein 5e-41 53
LSL_0522 YP_535414.1 two-component response regulator NC_007622.3794948.p0 Protein 5e-41 53
LSL_0522 YP_535414.1 two-component response regulator NC_003923.1003417.p0 Protein 5e-41 53
LSL_0522 YP_535414.1 two-component response regulator NC_013450.8614146.p0 Protein 5e-41 53
LSL_0522 YP_535414.1 two-component response regulator AE015929.1.gene1106. Protein 3e-38 52
LSL_0522 YP_535414.1 two-component response regulator BAC0308 Protein 9e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LSL_0522 YP_535414.1 two-component response regulator VFG1702 Protein 1e-25 43
LSL_0522 YP_535414.1 two-component response regulator VFG1390 Protein 3e-35 42
LSL_0522 YP_535414.1 two-component response regulator VFG1389 Protein 2e-29 42
LSL_0522 YP_535414.1 two-component response regulator VFG1563 Protein 1e-25 42
LSL_0522 YP_535414.1 two-component response regulator VFG0596 Protein 3e-27 41