Gene Information

Name : RPC_1830 (RPC_1830)
Accession : YP_531708.1
Strain : Rhodopseudomonas palustris BisB18
Genome accession: NC_007925
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1984118 - 1984807 bp
Length : 690 bp
Strand : +
Note : -

DNA sequence :
TTGCGTCTGCTCGTCGTTGAAGATGATCCCGATCTCAATCGTCAGCTCACCACCGCGCTGACCGACGCCGGCTATGTGGT
CGACCGCGCCTTCGACGGCGAGGAAGGCCACTTCCTCGGCGACACCGAGCCTTACGACGCGGTGGTGCTGGATATCGGCC
TGCCGAAGATGGACGGCATCTCGGTGCTGGAAGCCTGGCGGCGCAATCACCGCGCGATGCCGGTCTTGATCCTGACCGCG
CGCGACCGCTGGAGCGACAAGGTGCAGGGCTTCGACGCCGGCGCCGACGACTATGTCGCCAAGCCGTTTCATCTGGAAGA
GGTGCTGGCGCGGCTGCGCGCGCTGCTGCGCCGCTCCGCCGGTCACGCGCAGTCCGAACTGACCTGCGGCCCGGTGGTGC
TCGATACCCGCACCGGACGGGTCAGCGTCAACGGCAACCCGGTGAAGATGACCTCGCACGAATATCGGCTGTTGGCCTAT
CTGATGCACCATTCCGGACGCGTGGTGTCGCGCACCGAACTGGTCGAGCATCTGTACGACCAAGACTTCGATCGCGATTC
CAACACCATCGAGGTGTTCGTCGGCCGCATCCGCAAGAAGCTCGACGTCGACATCATCCAGACCGTGCGCGGGCTCGGCT
ATCTGCTGACGCCGCCGCCGGCTGCGCCCGCGGCCCATCAACGGCCTTGA

Protein sequence :
MRLLVVEDDPDLNRQLTTALTDAGYVVDRAFDGEEGHFLGDTEPYDAVVLDIGLPKMDGISVLEAWRRNHRAMPVLILTA
RDRWSDKVQGFDAGADDYVAKPFHLEEVLARLRALLRRSAGHAQSELTCGPVVLDTRTGRVSVNGNPVKMTSHEYRLLAY
LMHHSGRVVSRTELVEHLYDQDFDRDSNTIEVFVGRIRKKLDVDIIQTVRGLGYLLTPPPAAPAAHQRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-25 42
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-27 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPC_1830 YP_531708.1 two component transcriptional regulator NC_002516.2.879194.p Protein 1e-41 49
RPC_1830 YP_531708.1 two component transcriptional regulator CP000647.1.gene1136. Protein 1e-36 46
RPC_1830 YP_531708.1 two component transcriptional regulator BAC0530 Protein 1e-36 46
RPC_1830 YP_531708.1 two component transcriptional regulator CP001138.1.gene1939. Protein 3e-36 45
RPC_1830 YP_531708.1 two component transcriptional regulator CP004022.1.gene1005. Protein 3e-38 45
RPC_1830 YP_531708.1 two component transcriptional regulator CP001918.1.gene2526. Protein 3e-35 44
RPC_1830 YP_531708.1 two component transcriptional regulator NC_002695.1.913289.p Protein 1e-35 44
RPC_1830 YP_531708.1 two component transcriptional regulator CP000034.1.gene2022. Protein 4e-36 44
RPC_1830 YP_531708.1 two component transcriptional regulator BAC0487 Protein 4e-30 44
RPC_1830 YP_531708.1 two component transcriptional regulator BAC0347 Protein 7e-26 41
RPC_1830 YP_531708.1 two component transcriptional regulator BAC0111 Protein 5e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RPC_1830 YP_531708.1 two component transcriptional regulator VFG0475 Protein 3e-36 45
RPC_1830 YP_531708.1 two component transcriptional regulator VFG0596 Protein 4e-26 42
RPC_1830 YP_531708.1 two component transcriptional regulator VFG1390 Protein 2e-26 41
RPC_1830 YP_531708.1 two component transcriptional regulator VFG0473 Protein 1e-27 41