Gene Information

Name : Rfer_0510 (Rfer_0510)
Accession : YP_521793.1
Strain : Rhodoferax ferrireducens T118
Genome accession: NC_007908
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 529091 - 529795 bp
Length : 705 bp
Strand : -
Note : -

DNA sequence :
ATGACTCAACACCTATTGATGATCGAAGATGACACGCGCCTGGCCCAGATGGTGAGTGAGTACCTGGCGCAATCAGGGTT
TGTGGTGGGCCATGCCGGCGACGGCCAAACCGGGCTGACCGACCTGCAGTCCGACCCACCTGACCTGGTCATCCTGGATC
TGATGCTGCCTGACATGGACGGGCTGGAGGTGTGTCGGCGCATCCGCTCACTGCCCGGCGCCCTGGCGCAAATACCGGTG
CTGATGTTGACCGCCAAGGGCGACCCGATGGACCGCATCATCGGGCTGGAGATCGGCGCCGATGACTACCTGCCCAAGCC
GTTTGAGCCACGCGAGCTGCTGGCCCGCATTCGCGCTGTGTTACGCCGCCATGTGGAGGGCGCGCACCCCGTTCAAACAC
AGCTGCGTTTTGGCACACTGGAAATCGACCGCGACGCCCGCTCCGTCAGTGTGGCGGGCCAACTCTGCGACTTGACCTCT
TACCAGTTTGATCTGCTGGTGGCGCTGGCCGAGCGCGCCGGGCGGGTGCTCACGCGTGACCAGATCATGGAAGCCGTGCG
CGGACGTGAACTCGACGCCTTTGACCGCTCGATCGACGTGCACATGGGACGCATCCGCGCAGCCATTGAACTCGATGCCA
AGGATCCCAAGCGCATCCTCACGGTGCGCGGCGTCGGCTATGTATTCGCCCGCCAGCAAGACTGA

Protein sequence :
MTQHLLMIEDDTRLAQMVSEYLAQSGFVVGHAGDGQTGLTDLQSDPPDLVILDLMLPDMDGLEVCRRIRSLPGALAQIPV
LMLTAKGDPMDRIIGLEIGADDYLPKPFEPRELLARIRAVLRRHVEGAHPVQTQLRFGTLEIDRDARSVSVAGQLCDLTS
YQFDLLVALAERAGRVLTRDQIMEAVRGRELDAFDRSIDVHMGRIRAAIELDAKDPKRILTVRGVGYVFARQQD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-30 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rfer_0510 YP_521793.1 two component transcriptional regulator AE000516.2.gene3505. Protein 3e-37 46
Rfer_0510 YP_521793.1 two component transcriptional regulator CP000034.1.gene3671. Protein 1e-43 44
Rfer_0510 YP_521793.1 two component transcriptional regulator BAC0347 Protein 7e-29 43
Rfer_0510 YP_521793.1 two component transcriptional regulator NC_008702.1.4607594. Protein 1e-43 43
Rfer_0510 YP_521793.1 two component transcriptional regulator BAC0125 Protein 5e-30 42
Rfer_0510 YP_521793.1 two component transcriptional regulator AE015929.1.gene1106. Protein 4e-33 42
Rfer_0510 YP_521793.1 two component transcriptional regulator CP001485.1.gene721.p Protein 1e-39 42
Rfer_0510 YP_521793.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-41 42
Rfer_0510 YP_521793.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-34 41
Rfer_0510 YP_521793.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-34 41
Rfer_0510 YP_521793.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-34 41
Rfer_0510 YP_521793.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-34 41
Rfer_0510 YP_521793.1 two component transcriptional regulator CP000675.2.gene1535. Protein 6e-39 41
Rfer_0510 YP_521793.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-34 41
Rfer_0510 YP_521793.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-34 41
Rfer_0510 YP_521793.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-34 41
Rfer_0510 YP_521793.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rfer_0510 YP_521793.1 two component transcriptional regulator VFG0596 Protein 1e-30 43
Rfer_0510 YP_521793.1 two component transcriptional regulator VFG1390 Protein 9e-36 41