Gene Information

Name : DSY4391 (DSY4391)
Accession : YP_520624.1
Strain : Desulfitobacterium hafniense Y51
Genome accession: NC_007907
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4994567 - 4995280 bp
Length : 714 bp
Strand : -
Note : similarity to COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain(Evalue: 3E-60)

DNA sequence :
ATGCTGTTTTTGGGGAAAGTCTTGGTGGTCGACGACGACCAGAATGTCTTGGAACTGGTCAAGTTATATGGTGAGAGAGA
GGGTTTCGAAGTGGTCGCTGTCGACGACGGGGACCTGGTGCTGGCCGCCTTCGACCGGGAGAATCCGGATGTCGTCATCC
TGGATATCATGCTTCCCGGTCAGGACGGGCTTTCTTTGTGCCGAAGATTAAGGGCGGTGCGCATGATTCCGATCATTATG
CTGACGGCCAAAGGGGAAGAAGCGGACCGTGTTCTCGGCCTGGAAATGGGTGCCGACGATTATGTTGCCAAACCTTTCAG
CCCGCGGGAACTGGTCGCCAGGATCAAAGCGGTGCTGCGGCGCAGCCAGGCGGCGGACCCGGCCACGAATTGGCAGTTGA
AATACCCCGGGCTGGAAATCCGGGCCGATATCAGGAAAGTGCTGGTGGACGCCGCGGAAAGCGAAGTGACCCCCAGAGAA
TTCGATCTGCTTTATCACCTGGCCCAGAATCCCCAGCGGGTCTTTACCAGGGAGGAATTGCTGGGGGCTGTCTGGGGATA
TGACTACTTCGGCGATCAGCGTACAGTGGATGTTCATATTCGCAGGTTGCGGACAAAGCTGGCGTCTTTGCCCCACGAAT
ACCTGCAGACTGTTTGGGGTGTAGGGTACAAGTTCACACCTCCGGTCAAAGGAGGAGAGAGCGGTTTTGCGTAA

Protein sequence :
MLFLGKVLVVDDDQNVLELVKLYGEREGFEVVAVDDGDLVLAAFDRENPDVVILDIMLPGQDGLSLCRRLRAVRMIPIIM
LTAKGEEADRVLGLEMGADDYVAKPFSPRELVARIKAVLRRSQAADPATNWQLKYPGLEIRADIRKVLVDAAESEVTPRE
FDLLYHLAQNPQRVFTREELLGAVWGYDYFGDQRTVDVHIRRLRTKLASLPHEYLQTVWGVGYKFTPPVKGGESGFA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-36 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-36 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DSY4391 YP_520624.1 hypothetical protein NC_012469.1.7685629. Protein 5e-44 49
DSY4391 YP_520624.1 hypothetical protein NC_002952.2859905.p0 Protein 3e-44 48
DSY4391 YP_520624.1 hypothetical protein NC_013450.8614421.p0 Protein 4e-44 48
DSY4391 YP_520624.1 hypothetical protein NC_007793.3914279.p0 Protein 4e-44 48
DSY4391 YP_520624.1 hypothetical protein NC_007622.3794472.p0 Protein 3e-44 48
DSY4391 YP_520624.1 hypothetical protein NC_002745.1124361.p0 Protein 4e-44 48
DSY4391 YP_520624.1 hypothetical protein NC_009782.5559369.p0 Protein 4e-44 48
DSY4391 YP_520624.1 hypothetical protein NC_002951.3237708.p0 Protein 4e-44 48
DSY4391 YP_520624.1 hypothetical protein NC_003923.1003749.p0 Protein 3e-44 48
DSY4391 YP_520624.1 hypothetical protein NC_002758.1121668.p0 Protein 4e-44 48
DSY4391 YP_520624.1 hypothetical protein NC_009641.5332272.p0 Protein 4e-44 48
DSY4391 YP_520624.1 hypothetical protein AE000516.2.gene3505. Protein 1e-36 48
DSY4391 YP_520624.1 hypothetical protein HE999704.1.gene2815. Protein 7e-43 44
DSY4391 YP_520624.1 hypothetical protein AE015929.1.gene1106. Protein 1e-29 43
DSY4391 YP_520624.1 hypothetical protein AF155139.2.orf0.gene Protein 3e-39 43
DSY4391 YP_520624.1 hypothetical protein CP001918.1.gene5135. Protein 6e-24 43
DSY4391 YP_520624.1 hypothetical protein NC_010079.5776364.p0 Protein 5e-33 42
DSY4391 YP_520624.1 hypothetical protein NC_002952.2859858.p0 Protein 5e-33 42
DSY4391 YP_520624.1 hypothetical protein NC_007622.3794948.p0 Protein 5e-33 42
DSY4391 YP_520624.1 hypothetical protein NC_003923.1003417.p0 Protein 5e-33 42
DSY4391 YP_520624.1 hypothetical protein NC_013450.8614146.p0 Protein 5e-33 42
DSY4391 YP_520624.1 hypothetical protein NC_002951.3238224.p0 Protein 5e-33 42
DSY4391 YP_520624.1 hypothetical protein NC_007793.3914065.p0 Protein 5e-33 42
DSY4391 YP_520624.1 hypothetical protein NC_002758.1121390.p0 Protein 5e-33 42
DSY4391 YP_520624.1 hypothetical protein AE016830.1.gene1681. Protein 5e-38 42
DSY4391 YP_520624.1 hypothetical protein NC_012469.1.7686381. Protein 6e-39 42
DSY4391 YP_520624.1 hypothetical protein CP004022.1.gene3215. Protein 4e-26 42
DSY4391 YP_520624.1 hypothetical protein CP000034.1.gene3671. Protein 6e-40 42
DSY4391 YP_520624.1 hypothetical protein BAC0039 Protein 4e-33 42
DSY4391 YP_520624.1 hypothetical protein CP000034.1.gene2186. Protein 4e-33 42
DSY4391 YP_520624.1 hypothetical protein NC_002695.1.916589.p Protein 3e-33 42
DSY4391 YP_520624.1 hypothetical protein BAC0596 Protein 5e-33 42
DSY4391 YP_520624.1 hypothetical protein CP001138.1.gene2239. Protein 5e-33 42
DSY4391 YP_520624.1 hypothetical protein CP001138.1.gene4273. Protein 2e-25 41
DSY4391 YP_520624.1 hypothetical protein AM180355.1.gene1830. Protein 2e-34 41
DSY4391 YP_520624.1 hypothetical protein BAC0533 Protein 2e-25 41
DSY4391 YP_520624.1 hypothetical protein NC_002695.1.915041.p Protein 3e-25 41
DSY4391 YP_520624.1 hypothetical protein CP000647.1.gene4257. Protein 2e-25 41
DSY4391 YP_520624.1 hypothetical protein CP000034.1.gene3834. Protein 3e-25 41
DSY4391 YP_520624.1 hypothetical protein FJ349556.1.orf0.gene Protein 3e-38 41
DSY4391 YP_520624.1 hypothetical protein DQ212986.1.gene4.p01 Protein 3e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DSY4391 YP_520624.1 hypothetical protein VFG1563 Protein 1e-36 43
DSY4391 YP_520624.1 hypothetical protein VFG1702 Protein 1e-36 43
DSY4391 YP_520624.1 hypothetical protein VFG1389 Protein 2e-29 43