Name : rpmJ (CF0180) Accession : YP_515097.1 Strain : Chlamydophila felis Fe/C-56 Genome accession: NC_007899 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L36 Function : - COG functional category : - COG ID : - EC number : - Position : 211621 - 211758 bp Length : 138 bp Strand : + Note : smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc io DNA sequence : ATGAAAGTAAGTTCATCTATCAAAGCAGATCCTTCCAAGGGAGATAAGCTTGTTCGTCGTAAAGGGCGCCTTTATGTTAT TAATAAAAAGGATCCCAATCGTAAACAACGTCAAGCGGGTCCTGCACGCAAAAAATAA Protein sequence : MKVSSSIKADPSKGDKLVRRKGRLYVINKKDPNRKQRQAGPARKK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
rpmJ | YP_001800879.1 | 50S ribosomal protein L36 | Not tested | Not named | Protein | 0.012 | 53 |