Gene Information

Name : Saro_2122 (Saro_2122)
Accession : YP_497395.1
Strain : Novosphingobium aromaticivorans DSM 12444
Genome accession: NC_007794
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 2261421 - 2261816 bp
Length : 396 bp
Strand : -
Note : -

DNA sequence :
ATGGCAATGACCATTTCCGAACTGGCCAAGGGGGCGGGCGTCGGGGTCGAGACAGTCCGGTTCTATCAACGCAAGGGGCT
GCTGGACGATCCACGCCCAAGCCGCACGGCGCGGCAAGGGCAGCGGCATTACGGCCCGGAAGACCTCCGCCGCCTGCGCT
TCGTGCGCAGCGCGCAAGCTGCCGGCTTCACGCTGGCGGAAATTTCCGAGCTGCTGGCGCTCGATGCAGGGCATGACCGA
CCGCGCGCGCGGGAAATGGCGCGGGCCAGGCTCCATGCCATCGAACAGGAAATCGCGCGGCTGGAAGCGGCGCGGCAATC
GCTGCGCAAGCTGGCGCGCGAATGCGCCAAAGGCGATGCGGGGCCGTGCCCGATCATCGCGGCATTTGAGGGTTAG

Protein sequence :
MAMTISELAKGAGVGVETVRFYQRKGLLDDPRPSRTARQGQRHYGPEDLRRLRFVRSAQAAGFTLAEISELLALDAGHDR
PRAREMARARLHAIEQEIARLEAARQSLRKLARECAKGDAGPCPIIAAFEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 1e-18 43
merR ACK44535.1 MerR Not tested SGI1 Protein 1e-19 42
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 1e-19 42
merR AFG30124.1 MerR Not tested PAGI-2 Protein 1e-19 42
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-19 42
merR AGK07025.1 MerR Not tested SGI1 Protein 3e-19 42
merR AGK07083.1 MerR Not tested SGI1 Protein 3e-19 42
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-19 42
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-19 42
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 4e-10 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Saro_2122 YP_497395.1 MerR family transcriptional regulator BAC0688 Protein 1e-20 43
Saro_2122 YP_497395.1 MerR family transcriptional regulator BAC0687 Protein 6e-20 42
Saro_2122 YP_497395.1 MerR family transcriptional regulator BAC0686 Protein 1e-20 42
Saro_2122 YP_497395.1 MerR family transcriptional regulator BAC0684 Protein 3e-21 42
Saro_2122 YP_497395.1 MerR family transcriptional regulator BAC0232 Protein 6e-20 42
Saro_2122 YP_497395.1 MerR family transcriptional regulator BAC0683 Protein 1e-20 42
Saro_2122 YP_497395.1 MerR family transcriptional regulator BAC0689 Protein 1e-19 41