Gene Information

Name : Saro_2066 (Saro_2066)
Accession : YP_497339.1
Strain : Novosphingobium aromaticivorans DSM 12444
Genome accession: NC_007794
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2206348 - 2207025 bp
Length : 678 bp
Strand : -
Note : -

DNA sequence : 
ATGCGCATCCTGATCGTCGAGGATGAACCGACTCTCGGCAAGCAGCTCAAGAATACGCTCGAGCAGAACGGCTATGCCGT
CGATCTTTCCGTCGATGGCGAAGACGGCCATTTCCTGGGTTCGACCGAGGAATACGACGCCGTCATCCTCGATCTCGGCC
TGCCCGAAATCGACGGGCTGACCGTGCTGGGCATGTGGCGCAAGGAAGGCCGCAAGTTCCCGGTCCTCGTCCTCACCGCG
CGCGACAGCTGGTCCGACAAGGTCGCAGGGCTCGACGCGGGCGCAGACGATTACCTCGCAAAGCCTTTCCAGACCGAGGA
ACTGATCGCCCGCCTGCGCGCGCTGATCCGCCGCGCATCGGGCAATTCCTCGTCCGAGCTGACCGCAGGCGACGTGCGTC
TCGATACGCGCTCGGGCCGCGTCACGCTCAACGGCGAACCGGTCAAGCTTACCGCGCAGGAATACAAGCTCCTGTCCTAT
CTGCTGCATCACAAGGGCAAGGTCGTCAGCCGTACGGAACTGATCGAGCATATCTACGATCAGGACTTCGACCGCGATTC
CAACACGATCGAGGTCTTCGTCACGCGCATTCGCAAGAAGCTGGGGCCGGACGTGATCACCACGATCCGTGGCCTTGGCT
ACAGCCTCGACGATCCGGCCGAACCCGGCCGCGGCTAA

Protein sequence : 
MRILIVEDEPTLGKQLKNTLEQNGYAVDLSVDGEDGHFLGSTEEYDAVILDLGLPEIDGLTVLGMWRKEGRKFPVLVLTA
RDSWSDKVAGLDAGADDYLAKPFQTEELIARLRALIRRASGNSSSELTAGDVRLDTRSGRVTLNGEPVKLTAQEYKLLSY
LLHHKGKVVSRTELIEHIYDQDFDRDSNTIEVFVTRIRKKLGPDVITTIRGLGYSLDDPAEPGRG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Saro_2066 YP_497339.1 two component transcriptional regulator BAC0487 Protein 2e-26 46
Saro_2066 YP_497339.1 two component transcriptional regulator NC_002516.2.879194.p Protein 1e-31 45
Saro_2066 YP_497339.1 two component transcriptional regulator CP000647.1.gene1136. Protein 4e-31 43
Saro_2066 YP_497339.1 two component transcriptional regulator CP004022.1.gene1005. Protein 4e-30 43
Saro_2066 YP_497339.1 two component transcriptional regulator CP001918.1.gene2526. Protein 8e-30 43
Saro_2066 YP_497339.1 two component transcriptional regulator BAC0308 Protein 1e-22 43
Saro_2066 YP_497339.1 two component transcriptional regulator CP001138.1.gene1939. Protein 2e-30 43
Saro_2066 YP_497339.1 two component transcriptional regulator BAC0530 Protein 5e-31 43
Saro_2066 YP_497339.1 two component transcriptional regulator BAC0197 Protein 1e-25 42
Saro_2066 YP_497339.1 two component transcriptional regulator BAC0083 Protein 4e-22 42
Saro_2066 YP_497339.1 two component transcriptional regulator NC_002695.1.913289.p Protein 3e-30 42
Saro_2066 YP_497339.1 two component transcriptional regulator CP000034.1.gene2022. Protein 4e-30 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Saro_2066 YP_497339.1 two component transcriptional regulator VFG0473 Protein 7e-23 44
Saro_2066 YP_497339.1 two component transcriptional regulator VFG0475 Protein 1e-30 43
Saro_2066 YP_497339.1 two component transcriptional regulator VFG1390 Protein 7e-21 41