Gene Information

Name : Saro_1631 (Saro_1631)
Accession : YP_496905.1
Strain : Novosphingobium aromaticivorans DSM 12444
Genome accession: NC_007794
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1706922 - 1707605 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
ATGAGAATACTCATCATCGAGGACGAGATCGAACTGGCGGGTGCCTTGCACCGTGGCCTTACCCAGGAAGGCTGCAAGGT
CACCCTCGCGACCGACGGCTCCACAGGGCTAGAGCTTGCAGCCTCCCTCGCATTCGACTTCATCCTGCTCGACGTGAACC
TGCCGGACATGGATGGTTTCGAAGTCTGCGCGCGCCTGCGCGAACAGGGTTCCACCATGCCGATCATCATGGTTACGGCG
CGTGACGAGATTGCAGATCGCATTCGCGGGCTCAAGGGTGGCGCGGATGATTACCTGACCAAGCCTTTCGCGTTCGAGGA
ACTGCTGGCGCGCATGGACGCGATCAAGCGTCGCATGGCACCCTCGCAAGGTGGCAAGGTACAGCCCGATGGACGGATCA
CCGTCGGCGACCTACACTTCGATCCGCGCACGATGACCCTGACGAGGGCAGGCACGCCGGTGCAGCTCACGGTCAAGGAA
ATGGGTGTACTGCGTCTCTTGATGGAATCGCCGGGCACGGTGATCTCGCGCACCGAAATCCTTCGCGCAGTCTGGGGAAT
GGAGGACGATCCCCTGACCAACATTGTCGAAGTCTACCTGAGCCGACTGCGCCGCAAGCTCCACGCCCTCGGCCCGCCAG
TGGTCGAAAACGTGCGTGGCTTCGGGTACCGCCTGATCGCTTAA

Protein sequence :
MRILIIEDEIELAGALHRGLTQEGCKVTLATDGSTGLELAASLAFDFILLDVNLPDMDGFEVCARLREQGSTMPIIMVTA
RDEIADRIRGLKGGADDYLTKPFAFEELLARMDAIKRRMAPSQGGKVQPDGRITVGDLHFDPRTMTLTRAGTPVQLTVKE
MGVLRLLMESPGTVISRTEILRAVWGMEDDPLTNIVEVYLSRLRRKLHALGPPVVENVRGFGYRLIA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-34 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Saro_1631 YP_496905.1 two component transcriptional regulator BAC0125 Protein 1e-35 43
Saro_1631 YP_496905.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-35 42
Saro_1631 YP_496905.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-35 42
Saro_1631 YP_496905.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-35 42
Saro_1631 YP_496905.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-35 42
Saro_1631 YP_496905.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-35 42
Saro_1631 YP_496905.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-35 42
Saro_1631 YP_496905.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-35 42
Saro_1631 YP_496905.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-35 42
Saro_1631 YP_496905.1 two component transcriptional regulator HE999704.1.gene1528. Protein 5e-31 42
Saro_1631 YP_496905.1 two component transcriptional regulator BAC0197 Protein 3e-35 42
Saro_1631 YP_496905.1 two component transcriptional regulator BAC0111 Protein 3e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Saro_1631 YP_496905.1 two component transcriptional regulator VFG1390 Protein 6e-39 43
Saro_1631 YP_496905.1 two component transcriptional regulator VFG0596 Protein 8e-35 41