Gene Information

Name : SAUSA300_0056 (SAUSA300_0056)
Accession : YP_492775.1
Strain : Staphylococcus aureus FPR3757
Genome accession: NC_007793
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : S : Function unknown
COG ID : COG4333
EC number : -
Position : 65715 - 66218 bp
Length : 504 bp
Strand : -
Note : identified by match to protein family HMM PF07799

DNA sequence :
ATGAATACAATCAAAAGTACGATACACACAGAAGCGATATTTAGCGATGATGAACAACATCGCTACTTACTCAAAAAGAT
ATGGGATGACAAGAAACCGGCTTGTACTGTGATAACGATGTATCTTCATTTAGATGGTGTATTATCACTCGATCTTACTA
CGGTTCTCATCCTCAATCAATTAGCTAATTCTGAGCAATATGGCGCTGTTTATCTCGTTAATCTTTTCTCTAATATTAAA
ACACCAGAGAACCTTAAACATATCAAAGAGCCTTATGATGAGCACACAGATATACACTTAATGAAAGCAATTAGTGAAAG
TGACACAGTCATTCTTGCTTATGGTGCCTATGCGAAGCGACCAGTTGTTATCGACCGTGTCGAACAAGTGATGGAAATGT
TAAAACCTCATAAAAAGAAAGTAAAAAAGCTCATAAATCCAGTAACGAACGAAGTTATGCATCCACTCAACCCTAAAGCA
CGTCAAAAATGGACACTAAAGTAA

Protein sequence :
MNTIKSTIHTEAIFSDDEQHRYLLKKIWDDKKPACTVITMYLHLDGVLSLDLTTVLILNQLANSEQYGAVYLVNLFSNIK
TPENLKHIKEPYDEHTDIHLMKAISESDTVILAYGAYAKRPVVIDRVEQVMEMLKPHKKKVKKLINPVTNEVMHPLNPKA
RQKWTLK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAS0029 YP_042162.1 hypothetical protein Not tested SCC476 Protein 2e-66 95
unnamed BAG06215.2 hypothetical protein Not tested Type-VII SCCmec Protein 4e-67 95
MW0035 NP_644850.1 hypothetical protein Not tested Type-IV SCCmec Protein 1e-66 95
SAUSA300_0036 YP_492756.1 hypothetical protein Not tested Type-IV SCCmec Protein 1e-66 95
SACOL0037 YP_184948.1 hypothetical protein Not tested Type-I SCCmec Protein 6e-67 95
unnamed BAB72131.1 hypothetical protein Not tested Type-IVb SCCmec Protein 8e-67 95
unnamed BAC67564.1 hypothetical protein Not tested Type-IVc SCCmec Protein 8e-67 95
SAMSHR1132_00360 YP_005324560.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 1e-66 95
unnamed BAA94331.1 hypothetical protein Not tested Type-I SCCmec Protein 5e-67 95
unnamed BAB72112.1 hypothetical protein Not tested Type-IVa SCCmec Protein 8e-67 95
unnamed ACL99847.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-66 94
SAPIG0053 YP_005732863.1 hypothetical protein Not tested Type-V SCCmec Protein 7e-58 94
unnamed BAA94663.1 - Not tested Type-II SCCmec Protein 4e-65 93
SAR0056 YP_039527.1 hypothetical protein Not tested Type-II SCCmec Protein 6e-65 93
SERP2504 YP_190046.1 hypothetical protein Not tested Type-II SCCmec Protein 6e-65 93
SE0030 NP_763585.1 hypothetical protein Not tested SCCpbp4 Protein 3e-66 93
SAV0058 NP_370582.1 hypothetical protein Not tested Type-II SCCmec Protein 8e-65 93
SA0054 NP_373294.1 hypothetical protein Not tested Type-II SCCmec Protein 8e-65 93
SH0059 YP_251974.1 hypothetical protein Not tested SCCmec Protein 5e-65 92
unnamed BAD24838.1 hypothetical protein Not tested Type-V SCCmec Protein 2e-66 90
unnamed BAG06194.1 hypothetical protein Not tested Type-VII SCCmec Protein 4e-47 66
SARLGA251_00330 YP_005754048.1 hypothetical protein Not tested Type-XI SCCmec Protein 2e-48 66
unnamed BAB46979.2 hypothetical protein Not tested Type-IIIinv SCCmec Protein 2e-47 66
unnamed BAB47669.1 hypothetical protein Not tested Type-III SCCmec Protein 1e-47 66
unnamed BAC53831.1 hypothetical protein Not tested SRImec-III and SCCmec-III region Protein 1e-47 66
unnamed ACL99835.1 hypothetical protein Not tested Type-V SCCmec Protein 4e-47 66
SAPIG0037 YP_005732847.1 hypothetical protein Not tested Type-V SCCmec Protein 7e-47 66
SSP0031 YP_300121.1 hypothetical protein Not tested SCC15305RM Protein 2e-42 62
SSP0049 YP_300139.1 hypothetical protein Not tested SCC15305cap Protein 3e-41 61
unnamed BAB47602.1 hypothetical protein Not tested Type-III SCCmec Protein 4e-43 60
unnamed BAB46974.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 4e-43 60