Gene Information

Name : SAUSA300_0417 (SAUSA300_0417)
Accession : YP_493130.1
Strain : Staphylococcus aureus FPR3757
Genome accession: NC_007793
Putative virulence/resistance : Virulence
Product : tandem lipoprotein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 469538 - 470353 bp
Length : 816 bp
Strand : +
Note : identified by match to protein family HMM PF04507; match to protein family HMM TIGR01742

DNA sequence :
ATGATGGGGTATATAAAAAGAATGGCTTTATACATGAGTGTATTTCTTTTAATCATTTTTATTGTTGGATGTCGAAATAT
GAAAGATGAACAGAAAAAAGAAGAACAAACAAATAAAACAGATTCAAAAGAAGAACAAATCAAAAAGAGTTTTGAGAAAA
CATTAGATATGTATCCAATTAAGAATCTCGAGGAGTTATACGACAAAGAAGGATACCGAGATGGCGAATTTAAAAAGGGT
GATAAAGGGATGTGGACGATATATACAGATTTCGCCAAAAGTAATAAACAAGGTGGATTGAGTAATGAAGGTATGGTCTT
ATACTTAGATAGAAATACACGGACTGCAAAGGGACATTATTTTGTTAAGACATTCTATAATAAGGGCAAATTCCCAGATA
GAAAAAATTATAAAGTTGAAATGAAAAATAATAAAATTATCTTATTAGATAAAGTAGAAGATACAAATCTAAAAAAGAGA
ATAGAAAACTTTAAATTTTTTGGACAATATGCAAACCTTAAAGAATTGAAAAACTACAACAATGGTGATGTCTCAATTAA
TGAGAATGTTCCAAGTTATGACGCAAAATTTAAAATGAGCAATAAAGATGAAAATGTTAAGCAATTAAGAAGTCGTTATA
ATATTCCTACTGATAAAGCACCGGTATTAAAAATGCATATTGATGGTAATTTGAAAGGAAGTTCTGTGGGTTATAAAAAG
TTGGAAATTGACTTTTCAAAAGGTGGAAAAAGCGATTTGTCAGTAATAGATTCTTTGAATTTCCAGCCGGCGAAGGTAGA
TGAAGATGATGAATGA

Protein sequence :
MMGYIKRMALYMSVFLLIIFIVGCRNMKDEQKKEEQTNKTDSKEEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKG
DKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFYNKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKR
IENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKK
LEIDFSKGGKSDLSVIDSLNFQPAKVDEDDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SACOL0484 YP_185374.1 hypothetical protein Not tested vSa¥á Protein 3e-122 100
lpl7nm YP_001331444.1 tandem lipoprotein Not tested vSa¥á Protein 3e-122 100
SAUSA300_0417 YP_493130.1 tandem lipoprotein Not tested vSa¥á Protein 3e-122 100
lpl14 NP_645218.1 hypothetical protein Not tested vSa¥á Protein 2e-103 96
SAS0403 YP_042529.1 lipoprotein Not tested vSa¥á Protein 2e-114 94
SAKOR_00425 YP_008490609.1 Membrane lipoprotein Not tested vSa¥á Protein 6e-108 89
lpl7 NP_370967.1 hypothetical protein Not tested vSa¥á Protein 6e-108 89
lpl7 NP_373654.1 hypothetical protein Not tested vSa¥á Protein 6e-108 89
lpl9 NP_373656.1 hypothetical protein Not tested vSa¥á Protein 7e-108 88
lpl9 NP_370969.1 hypothetical protein Not tested vSa¥á Protein 7e-108 88
SAKOR_00428 YP_008490612.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-107 88
SAR0443 YP_039892.1 lipoprotein Not tested vSa¥á Protein 8e-106 87
SAMSHR1132_03930 YP_005324914.1 hypothetical protein Not tested vSa¥á Protein 1e-104 86
SAMSHR1132_03940 YP_005324915.1 putative lipoprotein Not tested vSa¥á Protein 2e-104 85
lpl3nm YP_001331440.1 tandem lipoprotein Not tested vSa¥á Protein 4e-99 80
SAUSA300_0413 YP_493126.1 tandem lipoprotein Not tested vSa¥á Protein 1e-98 79
SACOL0481 YP_185371.1 hypothetical protein Not tested vSa¥á Protein 5e-91 79
SAMSHR1132_03890 YP_005324910.1 putative lipoprotein Not tested vSa¥á Protein 8e-94 78
SAKOR_00423 YP_008490607.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-90 78
SAS0400 YP_042526.1 hypothetical protein Not tested vSa¥á Protein 1e-89 77
lpl11 NP_645215.1 hypothetical protein Not tested vSa¥á Protein 1e-89 77
SAUSA300_0414 YP_493127.1 tandem lipoprotein Not tested vSa¥á Protein 5e-89 77
SAKOR_00420 YP_008490604.1 Membrane lipoprotein Not tested vSa¥á Protein 6e-91 77
SAR0439 YP_039890.1 lipoprotein Not tested vSa¥á Protein 6e-91 76
lpl4nm YP_001331441.1 tandem lipoprotein Not tested vSa¥á Protein 6e-88 76
lpl4 NP_373651.1 hypothetical protein Not tested vSa¥á Protein 3e-91 76
SAV0440 NP_370964.1 hypothetical protein Not tested vSa¥á Protein 2e-91 76
lpl2nm YP_001331438.1 tandem lipoprotein Not tested vSa¥á Protein 2e-92 76
SAUSA300_0411 YP_493125.1 tandem lipoprotein Not tested vSa¥á Protein 2e-92 76
lpl1nm YP_001331437.1 tandem lipoprotein Not tested vSa¥á Protein 5e-91 76
SAR0442 YP_039891.1 hypothetical protein Not tested vSa¥á Protein 1e-88 75
SAUSA300_0410 YP_493124.1 tandem lipoprotein Not tested vSa¥á Protein 3e-90 75
lpl1 NP_370960.1 hypothetical protein Not tested vSa¥á Protein 1e-84 73
lpl1 NP_373647.1 hypothetical protein Virulence vSa¥á Protein 1e-84 73
SAMSHR1132_03860 YP_005324907.1 putative lipoprotein Not tested vSa¥á Protein 1e-87 73
lpl9nm YP_001331446.1 tandem lipoprotein Not tested vSa¥á Protein 4e-84 67
SACOL0486 YP_185376.1 hypothetical protein Not tested vSa¥á Protein 1e-84 67
SAUSA300_0419 YP_493132.1 tandem lipoprotein Not tested vSa¥á Protein 5e-84 66
SAKOR_00422 YP_008490606.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-81 65
SAS0401 YP_042527.1 lipoprotein Not tested vSa¥á Protein 3e-76 63
lpl12 NP_645216.1 hypothetical protein Not tested vSa¥á Protein 3e-76 63
SAMSHR1132_03900 YP_005324911.1 putative lipoprotein Not tested vSa¥á Protein 2e-69 62
lpl2 NP_373648.1 hypothetical protein Virulence vSa¥á Protein 2e-77 62
lpl2 NP_370961.1 hypothetical protein Not tested vSa¥á Protein 2e-77 62
lpl6 NP_370966.1 hypothetical protein Not tested vSa¥á Protein 8e-75 62
lpl6 NP_373653.1 hypothetical protein Not tested vSa¥á Protein 8e-75 62
SAR0438 YP_039889.1 lipoprotein Not tested vSa¥á Protein 4e-75 61
SAKOR_00424 YP_008490608.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-65 61
SAMSHR1132_03840 YP_005324905.1 putative lipoprotein Not tested vSa¥á Protein 1e-74 60
SAMSHR1132_03870 YP_005324908.1 putative lipoprotein Not tested vSa¥á Protein 4e-74 58
SAS0399 YP_042525.1 lipoprotein Not tested vSa¥á Protein 2e-71 58
lpl10 NP_645214.1 hypothetical protein Not tested vSa¥á Protein 2e-71 58
SAR0445 YP_039894.1 lipoprotein Not tested vSa¥á Protein 9e-68 56
lpl3 NP_370962.1 hypothetical protein Not tested vSa¥á Protein 3e-58 55
lpl3 NP_373649.1 hypothetical protein Virulence vSa¥á Protein 3e-58 55
SAKOR_00421 YP_008490605.1 Membrane lipoprotein Not tested vSa¥á Protein 6e-59 54
SAMSHR1132_03880 YP_005324909.1 putative lipoprotein Not tested vSa¥á Protein 8e-61 52
SAMSHR1132_03920 YP_005324913.1 putative lipoprotein Not tested vSa¥á Protein 8e-53 52
lpl8 NP_370968.1 hypothetical protein Not tested vSa¥á Protein 4e-47 52
lpl8 NP_373655.1 hypothetical protein Not tested vSa¥á Protein 4e-47 52
SAMSHR1132_03850 YP_005324906.1 putative lipoprotein Not tested vSa¥á Protein 2e-57 51
SAUSA300_0418 YP_493131.1 tandem lipoprotein Not tested vSa¥á Protein 2e-50 51
SACOL0485 YP_185375.1 hypothetical protein Not tested vSa¥á Protein 2e-50 51
lpl8nm YP_001331445.1 tandem lipoprotein Not tested vSa¥á Protein 2e-50 51
SAR0444 YP_039893.1 lipoprotein Not tested vSa¥á Protein 2e-51 51
unnamed AAL26686.1 unknown Not tested SCCcap1 Protein 1e-50 50
SAS0402 YP_042528.1 lipoprotein Not tested vSa¥á Protein 2e-59 50
lpl13 NP_645217.1 hypothetical protein Not tested vSa¥á Protein 2e-59 50
SACOL0483 YP_185373.1 staphyloccoccus tandem lipoprotein Not tested vSa¥á Protein 2e-54 49
lpl6nm YP_001331443.1 tandem lipoprotein Not tested vSa¥á Protein 2e-54 49
SAUSA300_0416 YP_493129.1 tandem lipoprotein Not tested vSa¥á Protein 2e-54 49
lpl5 NP_370965.1 hypothetical protein Not tested vSa¥á Protein 2e-50 48
lpl5 NP_373652.1 hypothetical protein Not tested vSa¥á Protein 2e-50 48
SAMSHR1132_03910 YP_005324912.1 putative lipoprotein Not tested vSa¥á Protein 6e-53 48
lpl3 YP_493128.1 tandem lipoprotein Not tested vSa¥á Protein 3e-52 48
SACOL0482 YP_185372.1 hypothetical protein Not tested vSa¥á Protein 1e-52 48
lpl5nm YP_001331442.1 tandem lipoprotein Not tested vSa¥á Protein 1e-52 48