Gene Information

Name : SAUSA300_0411 (SAUSA300_0411)
Accession : YP_493125.1
Strain : Staphylococcus aureus FPR3757
Genome accession: NC_007793
Putative virulence/resistance : Virulence
Product : tandem lipoprotein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 464429 - 465229 bp
Length : 801 bp
Strand : +
Note : identified by match to protein family HMM PF04507; match to protein family HMM TIGR01742

DNA sequence :
ATGCGATATCTAAAAAAGCTTGCATGGTTCATAAGTGTTATTATTTTGGGCATTTTTATAATAGGTTGTGATAGTTCAAG
CGATACTGGGGAAAAAGCAAAAGAAGATTCAAAGGAAGAACAAATCAAAAAGAGCTTTGCGAAAACATTAGATATGTATC
CAATTAAGAATCTCGAGGACTTATATGACAAAGAAGGATATCGAGATAGCGAATTTAAAAAAGGTGACAAAGGGATGTGG
ATGATATATACAGATTTCGCCAAAAGTAATAAACCGGGTGTATTAGATAATGAAGGTATGATTTTAAATTTGGATAGAAA
TACACGTACGGCCAAGGGATATTATTTTGTAGATACTATATATGACAATCATGAAAACTCTTATAGTAAAAATTATAGAG
TTGAGATGAAAAACAATAAAATTATTTTATTAGACAAGGTGGAAGATCAAAAACTTAAAGAAAGAATAGAAAACTTTAAA
TTTTTCGGACAATATGCCGATTTCAAGAGTTTGAAAAGTTACAACAATGGCGACGTTTCAATTAATAGTAATGTTCCAAG
TTATGACGCGAAATTTAAAATGAGTAATAAAGATGAAAATGTTAAGCAATTAAGAAGTCGTTATAACATTCCTACTGAAA
AAGCTCCAATATTAAAAATGCATATTGATGGGGACTTAAAAGGCAGTTCCGTTGGATATAAAAAGTTAGAAATAGACTTT
TCAAAAGAAGAAAATAGCGAATTATCAGTAGTCGATTCATTAAATTTTCAGCCTGCCAAAAAAAATAAAGATGATGAATG
A

Protein sequence :
MRYLKKLAWFISVIILGIFIIGCDSSSDTGEKAKEDSKEEQIKKSFAKTLDMYPIKNLEDLYDKEGYRDSEFKKGDKGMW
MIYTDFAKSNKPGVLDNEGMILNLDRNTRTAKGYYFVDTIYDNHENSYSKNYRVEMKNNKIILLDKVEDQKLKERIENFK
FFGQYADFKSLKSYNNGDVSINSNVPSYDAKFKMSNKDENVKQLRSRYNIPTEKAPILKMHIDGDLKGSSVGYKKLEIDF
SKEENSELSVVDSLNFQPAKKNKDDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAUSA300_0411 YP_493125.1 tandem lipoprotein Not tested vSa¥á Protein 2e-109 100
lpl2nm YP_001331438.1 tandem lipoprotein Not tested vSa¥á Protein 2e-108 99
lpl4 NP_373651.1 hypothetical protein Not tested vSa¥á Protein 1e-99 93
SAV0440 NP_370964.1 hypothetical protein Not tested vSa¥á Protein 1e-99 93
SAKOR_00420 YP_008490604.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-100 92
SAMSHR1132_03890 YP_005324910.1 putative lipoprotein Not tested vSa¥á Protein 6e-102 88
SAR0443 YP_039892.1 lipoprotein Not tested vSa¥á Protein 2e-90 81
SAKOR_00423 YP_008490607.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-88 81
lpl7 NP_373654.1 hypothetical protein Not tested vSa¥á Protein 6e-90 80
SAKOR_00425 YP_008490609.1 Membrane lipoprotein Not tested vSa¥á Protein 6e-90 80
lpl7 NP_370967.1 hypothetical protein Not tested vSa¥á Protein 6e-90 80
lpl14 NP_645218.1 hypothetical protein Not tested vSa¥á Protein 2e-86 80
SAR0442 YP_039891.1 hypothetical protein Not tested vSa¥á Protein 5e-82 79
SAS0400 YP_042526.1 hypothetical protein Not tested vSa¥á Protein 1e-82 79
lpl11 NP_645215.1 hypothetical protein Not tested vSa¥á Protein 1e-82 79
SAMSHR1132_03940 YP_005324915.1 putative lipoprotein Not tested vSa¥á Protein 7e-87 78
lpl3nm YP_001331440.1 tandem lipoprotein Not tested vSa¥á Protein 8e-89 78
SAUSA300_0413 YP_493126.1 tandem lipoprotein Not tested vSa¥á Protein 2e-89 78
SAUSA300_0414 YP_493127.1 tandem lipoprotein Not tested vSa¥á Protein 8e-82 78
SAMSHR1132_03860 YP_005324907.1 putative lipoprotein Not tested vSa¥á Protein 5e-82 78
SAR0439 YP_039890.1 lipoprotein Not tested vSa¥á Protein 2e-83 77
SAS0403 YP_042529.1 lipoprotein Not tested vSa¥á Protein 3e-86 77
lpl1nm YP_001331437.1 tandem lipoprotein Not tested vSa¥á Protein 1e-83 77
lpl4nm YP_001331441.1 tandem lipoprotein Not tested vSa¥á Protein 1e-80 77
SAMSHR1132_03930 YP_005324914.1 hypothetical protein Not tested vSa¥á Protein 1e-84 76
SACOL0484 YP_185374.1 hypothetical protein Not tested vSa¥á Protein 2e-85 76
lpl7nm YP_001331444.1 tandem lipoprotein Not tested vSa¥á Protein 2e-85 76
SAUSA300_0417 YP_493130.1 tandem lipoprotein Not tested vSa¥á Protein 2e-85 76
SACOL0481 YP_185371.1 hypothetical protein Not tested vSa¥á Protein 1e-82 76
lpl1 NP_370960.1 hypothetical protein Not tested vSa¥á Protein 1e-84 76
lpl1 NP_373647.1 hypothetical protein Virulence vSa¥á Protein 1e-84 76
SAUSA300_0410 YP_493124.1 tandem lipoprotein Not tested vSa¥á Protein 4e-83 76
lpl9 NP_373656.1 hypothetical protein Not tested vSa¥á Protein 1e-83 74
lpl9 NP_370969.1 hypothetical protein Not tested vSa¥á Protein 1e-83 74
SAKOR_00428 YP_008490612.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-83 74
lpl2 NP_370961.1 hypothetical protein Not tested vSa¥á Protein 3e-77 72
lpl2 NP_373648.1 hypothetical protein Virulence vSa¥á Protein 3e-77 72
SAS0401 YP_042527.1 lipoprotein Not tested vSa¥á Protein 2e-72 68
lpl12 NP_645216.1 hypothetical protein Not tested vSa¥á Protein 2e-72 68
SAMSHR1132_03870 YP_005324908.1 putative lipoprotein Not tested vSa¥á Protein 4e-75 68
SAMSHR1132_03900 YP_005324911.1 putative lipoprotein Not tested vSa¥á Protein 8e-70 67
SAR0438 YP_039889.1 lipoprotein Not tested vSa¥á Protein 8e-73 67
SAKOR_00422 YP_008490606.1 Membrane lipoprotein Not tested vSa¥á Protein 9e-76 67
SAKOR_00424 YP_008490608.1 Membrane lipoprotein Not tested vSa¥á Protein 1e-68 66
lpl6 NP_370966.1 hypothetical protein Not tested vSa¥á Protein 8e-73 65
lpl6 NP_373653.1 hypothetical protein Not tested vSa¥á Protein 8e-73 65
lpl9nm YP_001331446.1 tandem lipoprotein Not tested vSa¥á Protein 3e-72 64
SACOL0486 YP_185376.1 hypothetical protein Not tested vSa¥á Protein 4e-72 64
SAMSHR1132_03840 YP_005324905.1 putative lipoprotein Not tested vSa¥á Protein 3e-72 64
SAUSA300_0419 YP_493132.1 tandem lipoprotein Not tested vSa¥á Protein 5e-72 63
SAS0399 YP_042525.1 lipoprotein Not tested vSa¥á Protein 2e-68 62
lpl10 NP_645214.1 hypothetical protein Not tested vSa¥á Protein 2e-68 62
SAKOR_00421 YP_008490605.1 Membrane lipoprotein Not tested vSa¥á Protein 8e-56 60
SAMSHR1132_03850 YP_005324906.1 putative lipoprotein Not tested vSa¥á Protein 2e-57 56
lpl3 NP_370962.1 hypothetical protein Not tested vSa¥á Protein 1e-55 55
lpl3 NP_373649.1 hypothetical protein Virulence vSa¥á Protein 1e-55 55
SAMSHR1132_03880 YP_005324909.1 putative lipoprotein Not tested vSa¥á Protein 3e-55 54
lpl3 YP_493128.1 tandem lipoprotein Not tested vSa¥á Protein 3e-52 53
SACOL0482 YP_185372.1 hypothetical protein Not tested vSa¥á Protein 1e-52 53
lpl5nm YP_001331442.1 tandem lipoprotein Not tested vSa¥á Protein 1e-52 53
SAS0402 YP_042528.1 lipoprotein Not tested vSa¥á Protein 1e-55 53
lpl13 NP_645217.1 hypothetical protein Not tested vSa¥á Protein 1e-55 53
SAR0444 YP_039893.1 lipoprotein Not tested vSa¥á Protein 2e-55 53
unnamed AAL26686.1 unknown Not tested SCCcap1 Protein 2e-52 53
SACOL0485 YP_185375.1 hypothetical protein Not tested vSa¥á Protein 2e-54 52
lpl8nm YP_001331445.1 tandem lipoprotein Not tested vSa¥á Protein 2e-54 52
SAUSA300_0418 YP_493131.1 tandem lipoprotein Not tested vSa¥á Protein 2e-54 52
SAMSHR1132_03910 YP_005324912.1 putative lipoprotein Not tested vSa¥á Protein 6e-52 51
SAMSHR1132_03920 YP_005324913.1 putative lipoprotein Not tested vSa¥á Protein 2e-53 51
SACOL0483 YP_185373.1 staphyloccoccus tandem lipoprotein Not tested vSa¥á Protein 4e-52 51
lpl6nm YP_001331443.1 tandem lipoprotein Not tested vSa¥á Protein 4e-52 51
SAUSA300_0416 YP_493129.1 tandem lipoprotein Not tested vSa¥á Protein 4e-52 51
SAR0445 YP_039894.1 lipoprotein Not tested vSa¥á Protein 1e-53 50
lpl5 NP_370965.1 hypothetical protein Not tested vSa¥á Protein 3e-47 50
lpl5 NP_373652.1 hypothetical protein Not tested vSa¥á Protein 3e-47 50
lpl8 NP_370968.1 hypothetical protein Not tested vSa¥á Protein 5e-51 49
lpl8 NP_373655.1 hypothetical protein Not tested vSa¥á Protein 5e-51 49