
|
Name : rpmE2 (SAUSA300_2074) Accession : YP_494720.1 Strain : Staphylococcus aureus FPR3757 Genome accession: NC_007793 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L31 type B Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0254 EC number : - Position : 2235680 - 2235934 bp Length : 255 bp Strand : - Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g DNA sequence : ATGAAACAAGGAATTCATCCTGAGTATCACCAAGTAATCTTTTTAGATACTACTACAAACTTCAAATTCTTAAGCGGTTC TACAAAAACATCTTCAGAAATGATGGAGTGGGAAGATGGAAAAGAATACCCAGTTATTCGTTTAGATATTTCATCTGATT CACATCCATTCTACACTGGACGTCAAAAATTCGCTGCTGCGGATGGACGTGTGGAACGTTTCAACAAAAAGTTTGGTCTT AAATCAAACAACTAA Protein sequence : MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTGRQKFAAADGRVERFNKKFGL KSNN |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmE2 | NP_287095.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 5e-12 | 47 |
| rpmE2 | NP_286687.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 5e-12 | 47 |