Gene Information

Name : SAUSA300_1412 (SAUSA300_1412)
Accession : YP_494109.1
Strain : Staphylococcus aureus FPR3757
Genome accession: NC_007793
Putative virulence/resistance : Unknown
Product : phiSLT ORF 50-like protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1578090 - 1578242 bp
Length : 153 bp
Strand : -
Note : similar to transcriptional activator rinB; identified by match to protein family HMM PF06116

DNA sequence : 
ATGATTAAACAAATACTAAGACTATTATTCTTACTAGCAATGTATGAGTTAGGTAAGTATGTAACTGAGCAAGTGTATAT
TATGATGACGGCTAATGATGATGTAGAGGCGCCGAGTGATTACGAAAAAATCAGAGCTGAAGTTTCATGGTAA

Protein sequence : 
MIKQILRLLFLLAMYELGKYVTEQVYIMMTANDDVEAPSDYEKIRAEVSW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAUSA300_1412 YP_494109.1 phiSLT ORF 50-like protein Not tested ¥ÕSa2 Protein 8e-18 100
SAOV_0310 YP_005735827.1 transcriptional activator rinB Not tested ¥ÕSa1 Protein 3e-17 96
SAV1971 NP_372495.2 hypothetical protein Not tested ¥ÕSa3 Protein 3e-11 95
SAKOR_01951 YP_008492139.1 Transcriptional activator rinB Not tested ¥ÕSa3 Protein 3e-14 94
MW1916 NP_646733.1 hypothetical protein Not tested ¥ÕSa3 Protein 3e-14 94
SAS062 NP_375080.1 hypothetical protein Not tested ¥ÕSa3 Protein 3e-14 94
SAUSA300_1946 YP_494597.1 phiPVL ORF057-like protein, transcriptional activator RinB Not tested ¥ÕSa3 Protein 3e-14 94
SAUSA300_1946 YP_494597.1 phiPVL ORF057-like protein, transcriptional activator RinB Not tested ¥ÕSa3 Protein 3e-14 94
MW1411 NP_646228.1 hypothetical protein Not tested ¥ÕSa2 Protein 4e-17 94
SAOV_1096 YP_005736591.1 Transcriptional activator, phage associated Not tested ¥ÕSa2 Protein 7e-14 92
SAOV_1937c YP_005737381.1 transcriptional activator rinB Not tested ¥ÕSa3 Protein 7e-14 92
SAV0882 NP_371406.1 int gene activator RinB Not tested ¥ÕSa1 Protein 7e-14 83