Gene Information

Name : insN (Y75_p0246)
Accession : YP_488550.1
Strain : Escherichia coli K-12
Genome accession: NC_007779
Putative virulence/resistance : Unknown
Product : partial regulator of insertion element IS911A
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 269466 - 269870 bp
Length : 405 bp
Strand : +
Note : CP4-6 prophage region; ECK0257:JW5024:b0255

DNA sequence :
GTGATATGCTCACCTCAGAACAACACAGGTGTCATAATGAAAAAAAGAAATTTCAGCGCAGAGTTTAAACGCGAATCCGC
TCAACTGGTCGTTGACCAGAACTACACCGTGGCAGATGCAGCCAGCGCTATGGATGTCGGCCTTTCCACAATGACGCGAT
GGGTGAAACAATTACGTGATGAACGGCAGGGCAAAACACCAAAAGCCTCCCCCATTACCCCGGAACAAATTGAAATCCGT
GAGCTCAGGAAAAAGCTACAACGTATTGAAATGGAAAATGAAATATTAAAAAAGGCTACTGTAGATTCAATTGGTCAACG
CAACAGTTATGTGAAAACATGGGGTTGCGGAGGTTTTTTGAATGAGACGAACATTTACAGCAGAGGAAAAAGCCTCTGTT
TTTGA

Protein sequence :
MICSPQNNTGVIMKKRNFSAEFKRESAQLVVDQNYTVADAASAMDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIR
ELRKKLQRIEMENEILKKATVDSIGQRNSYVKTWGCGGFLNETNIYSRGKSLCF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-30 72
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-30 72
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-30 72
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-30 72
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-30 72
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-30 72
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-30 72
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-30 72
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 4e-21 55
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-21 55
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-21 54
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 1e-21 54
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 1e-21 54
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-19 47
tnpA CAB61575.1 transposase A Not tested HPI Protein 5e-19 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
insN YP_488550.1 partial regulator of insertion element IS911A VFG1123 Protein 4e-31 72
insN YP_488550.1 partial regulator of insertion element IS911A VFG0784 Protein 4e-22 54