Gene Information

Name : yeeU (Y75_p1965)
Accession : YP_490245.1
Strain : Escherichia coli K-12
Genome accession: NC_007779
Putative virulence/resistance : Virulence
Product : antitoxin of the YeeV-YeeU toxin-antitoxin system
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2079249 - 2079617 bp
Length : 369 bp
Strand : +
Note : CP4-44 prophage region; ECK1997:JW1986:b2004

DNA sequence :
GTGTCAGACACACTCCCCGGGACAACACTTCCCGACGACAATCACGACCGCCCCTGGTGGGGGCTGCCCTGCACCGTGAC
GCCCTGTTTCGGGGCACGTCTGGTGCAGGAGGGTAACCGGTTGCATTACCTTGCCGACCGCGCCGGTATCAGAGGCCTGT
TCAGCGATGCAGATGCGTACCACCTGGACCAGGCCTTTCCGCTGCTGATGAAACAACTGGAACTCATGCTCACCAGCGGT
GAACTGAATCCCCGCCATCAGCATACCGTCACGCTGTATGCAAAAGGGCTGACCTGCAAAGCCGATACCCTCAGCAGTTG
TGATTACGTTTATCTGGCTGTTTATCCGACGCCCGAAATGAAAAATTAA

Protein sequence :
MSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeU YP_853121.1 antitoxin of the YeeV-YeeU toxin-antitoxin system Virulence PAI IV APEC-O1 Protein 2e-53 99
unnamed CAD66206.1 hypothetical protein Not tested PAI III 536 Protein 7e-51 94
yeeU NP_838486.1 structural protein Not tested SHI-1 Protein 1e-49 94
yeeU NP_708772.1 structural protein Not tested SHI-1 Protein 1e-49 94
yeeU YP_854324.1 hypothetical protein Not tested PAI I APEC-O1 Protein 1e-49 94
yeeU AAZ04460.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 8e-50 94
unnamed AAK00481.1 unknown Not tested SHI-1 Protein 2e-49 93
yeeU CAD42100.1 hypothetical protein Not tested PAI II 536 Protein 1e-49 92
c5150 NP_756998.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-49 92
yeeU CAE85203.1 YeeU protein Not tested PAI V 536 Protein 3e-49 92
aec75 AAW51758.1 Aec75 Not tested AGI-3 Protein 2e-49 91
unnamed CAI43903.1 hypothetical protein Not tested LEE Protein 2e-49 91
yeeU ADD91700.1 YeeU Not tested PAI-I AL862 Protein 3e-48 90
Z1220 NP_286755.1 structural protein Not tested TAI Protein 8e-47 90
Z1658 NP_287161.1 structural protein Not tested TAI Protein 8e-47 90
unnamed AAL57576.1 unknown Not tested LEE Protein 4e-49 90
ECO103_3591 YP_003223448.1 hypothetical protein Not tested LEE Protein 1e-46 89
unnamed AAL67343.1 intergenic-region protein Not tested PAI II CFT073 Protein 7e-47 89
unnamed AAL08477.1 unknown Not tested SRL Protein 1e-46 88

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yeeU YP_490245.1 antitoxin of the YeeV-YeeU toxin-antitoxin system VFG1681 Protein 3e-51 94
yeeU YP_490245.1 antitoxin of the YeeV-YeeU toxin-antitoxin system VFG0662 Protein 3e-50 94
yeeU YP_490245.1 antitoxin of the YeeV-YeeU toxin-antitoxin system VFG1619 Protein 6e-50 92
yeeU YP_490245.1 antitoxin of the YeeV-YeeU toxin-antitoxin system VFG1068 Protein 6e-47 88