Gene Information

Name : Francci3_3677 (Francci3_3677)
Accession : YP_482758.1
Strain : Frankia sp. CcI3
Genome accession: NC_007777
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 4409767 - 4410342 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
GTGGGAGTCAGCCTCAGCAAGGGCGGCAACGTGTCGCTGACCAAGGAGGCGCCCGGACTCACCAACATCCTGGTCGGGCT
CGGCTGGGACGTTCGGAGCACAACCGGCGCGGACTTCGACCTGGACGCGAGCGCCATCGCGTGCCGGGCCGACGGCAAGG
TCGTGTCGGACGGGCACTTCGTCTTCTTCAACAACCTCAAGAGCCCCGACGGTGCGATCGAGCACCAGGGCGACAACCTG
ACCGGCGAGGGTGAGGGCGACGACGAGGCCATCACGGTGAACCTCACATCCCTGCCGGCGGAGATTGACAAGATCGTCTT
CCCGGTTTCGATCTATGACGCGGACTCGCGGCAGCAGAACTTCGGCCAGGTCCGCAACGCCTTCATCCGGATCGTCAACG
GCGCCGGCGGCAGCGAGATCGCCCGCTATGACCTCACCGAGGACGCCTCCACCGAGACGGCCATGGTGTTCGGCGAGGTC
TACCGGCACGGCGCGGACTGGAAGTTCCGAGCCGTCGGACAGGGCTACGCCTCGGGTCTGGCCGGGATCGCGCGCGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKEAPGLTNILVGLGWDVRSTTGADFDLDASAIACRADGKVVSDGHFVFFNNLKSPDGAIEHQGDNL
TGEGEGDDEAITVNLTSLPAEIDKIVFPVSIYDADSRQQNFGQVRNAFIRIVNGAGGSEIARYDLTEDASTETAMVFGEV
YRHGADWKFRAVGQGYASGLAGIARDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-60 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-60 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-60 66
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-61 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-59 64
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-59 64
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-58 63
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-55 60
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-29 44
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-26 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Francci3_3677 YP_482758.1 stress protein BAC0390 Protein 3e-60 65
Francci3_3677 YP_482758.1 stress protein BAC0389 Protein 1e-58 64