Gene Information

Name : CYA_1392 (CYA_1392)
Accession : YP_474826.1
Strain : Synechococcus sp. JA-3-3Ab
Genome accession: NC_007775
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1398863 - 1399594 bp
Length : 732 bp
Strand : -
Note : identified by match to protein family HMM PF00072; match to protein family HMM PF00486

DNA sequence :
GTGGAAGCCCAGCGCAAAGAACGGATTCTCGTGGTCGATGATGAGGCCAGCATCCGCCGCATTTTGGAGACCCGCCTCTC
GATGATCGGGTACGACGTGGTTACTGCTGCCGACGGAGAGGAGGCGCTGGAGGTTTTTCGCAAGCAGGATCCTGACCTGG
TGGTGCTGGATGTGATGATGCCGAAGCTGGATGGCTACGGGGTCTGCCAGGAGTTGCGCAAAGAATCCGACATCCCGATC
ATCATGCTCACGGCGTTGGGGGACGTGGCCGACCGCATTACTGGCTTGGAACTGGGGGCAGACGACTACGTGGTTAAGCC
GTTTTCGCCCAAAGAACTGGAGGCCCGCATTCGTTCGGTGCTGAGGCGGGTGGCGCGGTCGTCCCATGAAGGGATCCCCA
GCTCAGGGGTAATTCAGGTGGGGGATCTTCGCATCGATACCAACAAGCGGCAGGTTTACAAGCGGGACGAGCGCATCCGC
CTGACGGGGATGGAGTTTAGTTTGCTGGAGCTGCTGGTCAGCCGGTCGGGGGAGCCGTTTTCCCGCGCCGAGATTTTGCA
AGAGGTGTGGGGCTACACGCCGGAGCGCCACGTGGATACGCGGGTGGTGGATGTCCACATCTCGCGGCTGCGGGCCAAGT
TGGAGGATGACCCGAGCAACCCTGAGCTTATCCTGACAGCCCGCGGTACCGGCTATCTGTTTCAGCGCATCGTTCCAAAA
GGCGAGGAGTAG

Protein sequence :
MEAQRKERILVVDDEASIRRILETRLSMIGYDVVTAADGEEALEVFRKQDPDLVVLDVMMPKLDGYGVCQELRKESDIPI
IMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRVARSSHEGIPSSGVIQVGDLRIDTNKRQVYKRDERIR
LTGMEFSLLELLVSRSGEPFSRAEILQEVWGYTPERHVDTRVVDVHISRLRAKLEDDPSNPELILTARGTGYLFQRIVPK
GEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-31 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CYA_1392 YP_474826.1 DNA-binding response regulator NC_003923.1003749.p0 Protein 2e-47 49
CYA_1392 YP_474826.1 DNA-binding response regulator NC_002745.1124361.p0 Protein 2e-47 49
CYA_1392 YP_474826.1 DNA-binding response regulator NC_009782.5559369.p0 Protein 2e-47 49
CYA_1392 YP_474826.1 DNA-binding response regulator NC_002951.3237708.p0 Protein 2e-47 49
CYA_1392 YP_474826.1 DNA-binding response regulator NC_002758.1121668.p0 Protein 2e-47 49
CYA_1392 YP_474826.1 DNA-binding response regulator NC_007622.3794472.p0 Protein 2e-47 49
CYA_1392 YP_474826.1 DNA-binding response regulator NC_009641.5332272.p0 Protein 2e-47 49
CYA_1392 YP_474826.1 DNA-binding response regulator NC_013450.8614421.p0 Protein 2e-47 49
CYA_1392 YP_474826.1 DNA-binding response regulator NC_007793.3914279.p0 Protein 2e-47 49
CYA_1392 YP_474826.1 DNA-binding response regulator NC_002952.2859905.p0 Protein 2e-47 49
CYA_1392 YP_474826.1 DNA-binding response regulator NC_012469.1.7685629. Protein 5e-44 47
CYA_1392 YP_474826.1 DNA-binding response regulator BAC0125 Protein 1e-38 46
CYA_1392 YP_474826.1 DNA-binding response regulator AE000516.2.gene3505. Protein 2e-42 46
CYA_1392 YP_474826.1 DNA-binding response regulator HE999704.1.gene2815. Protein 1e-42 46
CYA_1392 YP_474826.1 DNA-binding response regulator CP000034.1.gene3671. Protein 9e-39 44
CYA_1392 YP_474826.1 DNA-binding response regulator CP001918.1.gene5135. Protein 3e-26 43
CYA_1392 YP_474826.1 DNA-binding response regulator BAC0197 Protein 1e-34 43
CYA_1392 YP_474826.1 DNA-binding response regulator BAC0308 Protein 4e-36 42
CYA_1392 YP_474826.1 DNA-binding response regulator BAC0083 Protein 2e-35 42
CYA_1392 YP_474826.1 DNA-binding response regulator BAC0638 Protein 3e-28 42
CYA_1392 YP_474826.1 DNA-binding response regulator NC_003923.1003417.p0 Protein 1e-35 41
CYA_1392 YP_474826.1 DNA-binding response regulator NC_013450.8614146.p0 Protein 1e-35 41
CYA_1392 YP_474826.1 DNA-binding response regulator NC_002951.3238224.p0 Protein 1e-35 41
CYA_1392 YP_474826.1 DNA-binding response regulator NC_007793.3914065.p0 Protein 1e-35 41
CYA_1392 YP_474826.1 DNA-binding response regulator NC_002758.1121390.p0 Protein 1e-35 41
CYA_1392 YP_474826.1 DNA-binding response regulator NC_010079.5776364.p0 Protein 1e-35 41
CYA_1392 YP_474826.1 DNA-binding response regulator NC_002952.2859858.p0 Protein 1e-35 41
CYA_1392 YP_474826.1 DNA-binding response regulator NC_007622.3794948.p0 Protein 1e-35 41
CYA_1392 YP_474826.1 DNA-binding response regulator HE999704.1.gene1528. Protein 2e-31 41
CYA_1392 YP_474826.1 DNA-binding response regulator CP004022.1.gene3215. Protein 1e-34 41
CYA_1392 YP_474826.1 DNA-binding response regulator NC_002695.1.915041.p Protein 5e-29 41
CYA_1392 YP_474826.1 DNA-binding response regulator CP000647.1.gene4257. Protein 5e-30 41
CYA_1392 YP_474826.1 DNA-binding response regulator CP000034.1.gene3834. Protein 5e-29 41
CYA_1392 YP_474826.1 DNA-binding response regulator CP001138.1.gene4273. Protein 2e-29 41
CYA_1392 YP_474826.1 DNA-binding response regulator BAC0533 Protein 5e-30 41
CYA_1392 YP_474826.1 DNA-binding response regulator NC_012469.1.7686381. Protein 3e-41 41
CYA_1392 YP_474826.1 DNA-binding response regulator AE016830.1.gene1681. Protein 4e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CYA_1392 YP_474826.1 DNA-binding response regulator VFG1390 Protein 9e-40 44
CYA_1392 YP_474826.1 DNA-binding response regulator VFG1389 Protein 3e-32 43
CYA_1392 YP_474826.1 DNA-binding response regulator VFG0596 Protein 2e-31 42