Gene Information

Name : CYA_1033 (CYA_1033)
Accession : YP_474491.1
Strain : Synechococcus sp. JA-3-3Ab
Genome accession: NC_007775
Putative virulence/resistance : Resistance
Product : DNA-binding response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1050354 - 1051103 bp
Length : 750 bp
Strand : +
Note : identified by match to protein family HMM PF00072; match to protein family HMM PF00486

DNA sequence :
ATGCAAGCAACCCTTTCCATGACCAGTCAACTTCCCGAAGTTCAAGTCAAGGAAGCTCCTCCCCTTCTGGAGACTCTGCT
GGTGGTGGACGATGAGGATGCAATCCGAGAAACCGTTGCCGTTGCTCTCGAAGAACAGGGATACCAAGTTTTGCAGGCCG
CCGATGGTCGACAAGCGCTGGAGCTGGTTCACACGGCCGAACGGCTGGATTTGATGATCTTGGATTTGATGCTGCCCGGC
TTGAACGGCTTGGATCTGTGCCGGCTGTTGCGCCGGGAGGGCAACACCATCCCCATCCTGATGCTGACGGCCAAAAGCAG
CGAGACCGACCGGGTGGTGGGCCTGGAGCTGGGAGCCGACGACTACCTGACCAAGCCCTTCGGCATGCGGGAGCTGATCG
CCCGCTGTCGCTCCGTGTTGCGCCGTCGGCAGCAGTCCCACGCCAGCGAGGCCACGGTGCTCCGCTACGGGGATATTTGC
ATGTTTACCCAAGAGTGTCGCGTCTTGGTGCGGGGAGTGGAGGTGAGTTTCTCGCCTAAGGAGTTCCGCCTGCTGGAGCT
GTTTATGTCCAACCCTCGCCGCGTCTGGACGCGGGAACAGCTCTTGGAGCGCATCTGGGGATCCGACTTCATGGGCGACA
GCAAAACGGTGGACGTCCACATCCGCTGGCTGCGGGAAAAGTTGGAGCTGGATCCCAGCAACCCAGAGTATTTGGTGACG
GTGCGCGGCTTCGGCTATCGCTTTGGCTAG

Protein sequence :
MQATLSMTSQLPEVQVKEAPPLLETLLVVDDEDAIRETVAVALEEQGYQVLQAADGRQALELVHTAERLDLMILDLMLPG
LNGLDLCRLLRREGNTIPILMLTAKSSETDRVVGLELGADDYLTKPFGMRELIARCRSVLRRRQQSHASEATVLRYGDIC
MFTQECRVLVRGVEVSFSPKEFRLLELFMSNPRRVWTREQLLERIWGSDFMGDSKTVDVHIRWLREKLELDPSNPEYLVT
VRGFGYRFG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-25 43
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 5e-27 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-24 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 6e-27 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-35 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CYA_1033 YP_474491.1 DNA-binding response regulator AE016830.1.gene1681. Protein 3e-48 49
CYA_1033 YP_474491.1 DNA-binding response regulator NC_002952.2859905.p0 Protein 4e-39 47
CYA_1033 YP_474491.1 DNA-binding response regulator NC_013450.8614421.p0 Protein 3e-39 47
CYA_1033 YP_474491.1 DNA-binding response regulator NC_007793.3914279.p0 Protein 3e-39 47
CYA_1033 YP_474491.1 DNA-binding response regulator NC_007622.3794472.p0 Protein 4e-39 47
CYA_1033 YP_474491.1 DNA-binding response regulator NC_002745.1124361.p0 Protein 3e-39 47
CYA_1033 YP_474491.1 DNA-binding response regulator NC_009782.5559369.p0 Protein 3e-39 47
CYA_1033 YP_474491.1 DNA-binding response regulator NC_002951.3237708.p0 Protein 3e-39 47
CYA_1033 YP_474491.1 DNA-binding response regulator NC_003923.1003749.p0 Protein 3e-39 47
CYA_1033 YP_474491.1 DNA-binding response regulator NC_002758.1121668.p0 Protein 3e-39 47
CYA_1033 YP_474491.1 DNA-binding response regulator NC_009641.5332272.p0 Protein 3e-39 47
CYA_1033 YP_474491.1 DNA-binding response regulator NC_012469.1.7685629. Protein 5e-41 46
CYA_1033 YP_474491.1 DNA-binding response regulator NC_012469.1.7686381. Protein 1e-41 44
CYA_1033 YP_474491.1 DNA-binding response regulator HE999704.1.gene2815. Protein 6e-46 44
CYA_1033 YP_474491.1 DNA-binding response regulator AE000516.2.gene3505. Protein 4e-34 43
CYA_1033 YP_474491.1 DNA-binding response regulator AF310956.2.orf0.gene Protein 2e-27 42
CYA_1033 YP_474491.1 DNA-binding response regulator BAC0197 Protein 6e-27 42
CYA_1033 YP_474491.1 DNA-binding response regulator CP000034.1.gene3671. Protein 3e-37 42
CYA_1033 YP_474491.1 DNA-binding response regulator U35369.1.gene1.p01 Protein 3e-27 41
CYA_1033 YP_474491.1 DNA-binding response regulator AE016830.1.gene2255. Protein 3e-27 41
CYA_1033 YP_474491.1 DNA-binding response regulator HE999704.1.gene1528. Protein 2e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CYA_1033 YP_474491.1 DNA-binding response regulator VFG1390 Protein 3e-39 44
CYA_1033 YP_474491.1 DNA-binding response regulator VFG0596 Protein 2e-25 43
CYA_1033 YP_474491.1 DNA-binding response regulator VFG1389 Protein 1e-31 42
CYA_1033 YP_474491.1 DNA-binding response regulator VFG1563 Protein 3e-35 41
CYA_1033 YP_474491.1 DNA-binding response regulator VFG1702 Protein 3e-35 41