Gene Information

Name : RHE_PA00099 (RHE_PA00099)
Accession : YP_471690.1
Strain :
Genome accession: NC_007762
Putative virulence/resistance : Unknown
Product : insertion sequence transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 109064 - 109411 bp
Length : 348 bp
Strand : -
Note : Similar to orfB (AF357834) of ISRm15 [Sinorhizobium meliloti]; Similar to entrez-protein:AAK48896.1; location:bacterial cytoplasm Psort-Score: 0.0905

DNA sequence :
ATGATCGGCCCATCGGGGAATGTGAGGGTCTATCTGGCCTGCGGAGTGACCGATATGCGGCGTGGCATTGATGGTCTGTC
CGCGCTGGTCGAGACGGTCGTGAGGGAGGCACCGGGCTCGGGCGCAATCTTCGGCTTTCGCGGAAAACGCGCGGACCGGA
TCAAGCTGCTTTGGTGGGATGGCCAGGGGTTCTGTCTGTTCTACAAGATTTTGGAGCGCGGATACTTTCCCTGGCCGACG
GCGAAAGAGGGTGTAGCGCACCTGACGCAGGCGCAGCTTTCGATGCTCGTTGAGGGGATCGATTGGCGACGCCCGGCGTG
GACTTCCGCTCCCGGCCGAACGGGATAA

Protein sequence :
MIGPSGNVRVYLACGVTDMRRGIDGLSALVETVVREAPGSGAIFGFRGKRADRIKLLWWDGQGFCLFYKILERGYFPWPT
AKEGVAHLTQAQLSMLVEGIDWRRPAWTSAPGRTG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 1e-20 54
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-24 52
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-24 52
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-24 52
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-24 52
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-24 52
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-24 52
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-23 52
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-23 52
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-24 52
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-24 52
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-24 52
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 4e-26 51
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 4e-26 51
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-24 51
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-24 51
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 3e-23 50
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 8e-26 50
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 3e-23 50
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-22 48
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-22 48
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-16 47
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-22 46
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 3e-21 45
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 3e-21 45
Z1163 NP_286698.1 hypothetical protein Not tested TAI Protein 9e-12 41
Z1602 NP_287106.1 hypothetical protein Not tested TAI Protein 9e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RHE_PA00099 YP_471690.1 insertion sequence transposase VFG1052 Protein 6e-25 52
RHE_PA00099 YP_471690.1 insertion sequence transposase VFG1709 Protein 4e-25 52
RHE_PA00099 YP_471690.1 insertion sequence transposase VFG0792 Protein 4e-25 52
RHE_PA00099 YP_471690.1 insertion sequence transposase VFG1698 Protein 1e-24 51
RHE_PA00099 YP_471690.1 insertion sequence transposase VFG1665 Protein 3e-26 50
RHE_PA00099 YP_471690.1 insertion sequence transposase VFG1517 Protein 8e-17 47
RHE_PA00099 YP_471690.1 insertion sequence transposase VFG1737 Protein 9e-23 46