Gene Information

Name : fliQ (RHE_CH00685)
Accession : YP_468228.1
Strain : Rhizobium etli CFN 42
Genome accession: NC_007761
Putative virulence/resistance : Virulence
Product : flagellar biosynthesis protein FliQ
Function : -
COG functional category : N : Cell motility
COG ID : COG1987
EC number : -
Position : 703773 - 704039 bp
Length : 267 bp
Strand : +
Note : FliQ, with proteins FliP and FliR, forms the core of the central channel in the flagella export apparatus; Bradyrhizobium have one thick flagellum and several thin flagella; the protein in this cluster is associated with the thick flagellum

DNA sequence : 
ATGAATGAAGCTGATGCATTGGATCTGTTCCAGGCGGCAATCTGGACCGTGCTGATTGCCTCCGGTCCGGCGGTCCTCGC
CGCGATGGTGGTGGGTCTCGTCATTGCCTTGATCCAGGCGTTGACCCAGGTGCAGGAAGCGACACTCACCTTCGTGCCGA
AGATTGTCGCAGTGCTCGTCGTGGTCGGAATCACCGCCCCCTTCGTCGGCTCGCAGATCTCCATTTTCACCAATCTGGTC
TTTTCGCGCATCCAGTCCGGCTTCTAG

Protein sequence : 
MNEADALDLFQAAIWTVLIASGPAVLAAMVVGLVIALIQALTQVQEATLTFVPKIVAVLVVVGITAPFVGSQISIFTNLV
FSRIQSGF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
lscS AAO18039.1 LscS Virulence TTSS locus Protein 7e-11 44
escS AFO66341.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 2e-08 42
escS AFO66401.1 putative LEE-encoded type III secretion system factor Virulence SESS LEE Protein 2e-08 42
escS AAK26701.1 EscS Virulence LEE Protein 4e-09 41
unnamed AAL06355.1 EscS Virulence LEE Protein 4e-09 41
escS AAL57528.1 EscS Virulence LEE Protein 4e-09 41
escS CAC81848.1 EscS protein Virulence LEE II Protein 4e-09 41
escS YP_003223489.1 T3SS structure protein EscS Virulence LEE Protein 5e-09 41
escS YP_003232139.1 T3SS structure protein EscS Virulence LEE Protein 5e-09 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
fliQ YP_468228.1 flagellar biosynthesis protein FliQ VFG0395 Protein 1e-11 42
fliQ YP_468228.1 flagellar biosynthesis protein FliQ VFG0187 Protein 2e-06 41