Name : RHE_CH03257 (RHE_CH03257) Accession : YP_470748.1 Strain : Rhizobium etli CFN 42 Genome accession: NC_007761 Putative virulence/resistance : Resistance Product : methyl viologen/ethidium resistance transmembrane protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2076 EC number : - Position : 3425453 - 3425794 bp Length : 342 bp Strand : - Note : similar to emrE (SMc01523) [Sinorhizobium meliloti] and Atu2319 [Agrobacterium tumefaciens str. C58]; Similar to swissprot:Q92N24; location:bacterial inner membrane Psort-Score: 0.4715 DNA sequence : ATGAGCCAGGCCGCCATTTACGGGCTGCTTTTTGCAGCCATCGTGCTCGAAGTCATCGGCACGACTGCGCTGCAATTGTC GCAGCAGTTCACCCGCATGGGGCCGACGGCCCTTGTCGTCGCTTGCTATGCGGCGGCGTTTTACTGCCTGTCGCTGACGC TGAAGAGCATTCCCGTTGGCATCGCCTATGCGATTTGGAGCGCTTTGGGGATCGTGCTGATTTCCTCGGTCGGCCTCGTC TTCTTCAAGCAGCGCCTCGATCTGCCGGCGATCATCGGCCTCGGGCTGATCATATCCGGCGTCGTCGTCGTCAACCTGTT CTCGAAAACCATTTCACATTGA Protein sequence : MSQAAIYGLLFAAIVLEVIGTTALQLSQQFTRMGPTALVVACYAAAFYCLSLTLKSIPVGIAYAIWSALGIVLISSVGLV FFKQRLDLPAIIGLGLIISGVVVVNLFSKTISH |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
qacEdelta1 | AGK07016.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-16 | 54 |
qacE-delta1 | AET25389.1 | QacE-delta1 | Not tested | PAGI-2(C) | Protein | 9e-16 | 54 |
qacEdelta1 | ABZ01839.1 | QacEdelta1 | Not tested | SGI2 | Protein | 9e-16 | 54 |
ACICU_00227 | YP_001844886.1 | membrane transporter | Not tested | AbaR20 | Protein | 1e-15 | 54 |
qacEdelta1 | AGK07074.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-16 | 54 |
qacE-delta1 | AFG30112.1 | QacE-delta1 | Not tested | PAGI-2 | Protein | 9e-16 | 54 |
qacEdelta1 | CAJ77030.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 9e-16 | 54 |
qacEdelta1 | YP_005797134.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 1e-15 | 54 |
qacEdelta1 | AGK07100.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-16 | 54 |
qacEdelta1 | AGF34989.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-16 | 54 |
qacEdelta1 | CAJ77049.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 9e-16 | 54 |
qacEdelta1 | YP_005797150.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 1e-15 | 54 |
qacEdelta1 | AGK07109.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-16 | 54 |
qacEdelta1 | AGF35028.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-16 | 54 |
qacEdelta1 | CAJ77052.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 9e-16 | 54 |
ebr | YP_006098377.1 | putative ethidium bromide resistance protein | Not tested | Tn2411 | Protein | 1e-15 | 54 |
qacEdelta1 | AFV53123.1 | QacEdelta1 multidrug exporter | Not tested | AbGRI2-1 | Protein | 9e-16 | 54 |
qacEdelta1 | AGF35063.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-16 | 54 |
qacEdelta1 | CAJ77088.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 9e-16 | 54 |
qacEdelta1 | ACN81026.1 | QacEdelta1 | Not tested | AbaR5 | Protein | 1e-15 | 54 |
qacEdelta1 | AGK36647.1 | QacEdelta1 | Not tested | AbaR26 | Protein | 9e-16 | 54 |
qacEdelta1 | AGK06933.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-16 | 54 |
qacE-deltal | ACF06159.1 | quartenary ammonium compound resistance protein | Not tested | Tn5036-like | Protein | 9e-16 | 54 |
qacEdelta1 | AAK02047.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 9e-16 | 54 |
qacEdelta1 | AGK06970.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-16 | 54 |
qacE-delta1 | ACY75523.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 9e-16 | 54 |
qacEdelta1 | AAK02056.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 9e-16 | 54 |
qacEdelta1 | AGK06979.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-16 | 54 |
qacE-delta1 | ACY75532.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 9e-16 | 54 |
qacEdelta1 | ABB48428.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-16 | 54 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
RHE_CH03257 | YP_470748.1 | methyl viologen/ethidium resistance transmembrane protein | CP001138.1.gene1489. | Protein | 3e-19 | 54 |
RHE_CH03257 | YP_470748.1 | methyl viologen/ethidium resistance transmembrane protein | BAC0322 | Protein | 4e-16 | 54 |
RHE_CH03257 | YP_470748.1 | methyl viologen/ethidium resistance transmembrane protein | BAC0323 | Protein | 4e-16 | 54 |
RHE_CH03257 | YP_470748.1 | methyl viologen/ethidium resistance transmembrane protein | CP004022.1.gene1549. | Protein | 7e-13 | 51 |
RHE_CH03257 | YP_470748.1 | methyl viologen/ethidium resistance transmembrane protein | BAC0140 | Protein | 8e-09 | 43 |