Name : RHE_CH02015 (RHE_CH02015) Accession : YP_469527.1 Strain : Rhizobium etli CFN 42 Genome accession: NC_007761 Putative virulence/resistance : Unknown Product : insertion sequence transposase Function : - COG functional category : L : Replication, recombination and repair COG ID : COG3436 EC number : - Position : 2109497 - 2109790 bp Length : 294 bp Strand : - Note : similar to hypothetical protein (in IS1131) [Agrobacterium tumefaciens] and Z0366 (in ISEc8)[Escherichia coli O157:H7 EDL933]; Similar to entrez-protein:JC1151; location:bacterial cytoplasm Psort-Score: 0.1184 DNA sequence : ATGCGGCGTGGCATTGATGGTCTGTCCGCGCTGGTCGAGACGGTCGTGAGGGAGGCACCGGGCTCGGGCGCAATCTTCGG CTTTCGCGGAAAACGCGCGGACCGGATCAAGCTGCTTTGGTGGGATGGCCAGGGGTTCTGTCTGTTCTACAAGATTTTGG AGCGCGGATACTTTCCCTGGCCGACGGCGAAAGAGGGTGTAGCGCACCTGACGCAGGCGCAGCTTTCGATGCTCGTTGAG GGGATCGATTGGCGACGCCCGGCGTGGACTTCCGCTCCCGGCCGAACGGGATAA Protein sequence : MRRGIDGLSALVETVVREAPGSGAIFGFRGKRADRIKLLWWDGQGFCLFYKILERGYFPWPTAKEGVAHLTQAQLSMLVE GIDWRRPAWTSAPGRTG |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | AAL08461.1 | unknown | Not tested | SRL | Protein | 2e-21 | 56 |
unnamed | AAC31493.1 | L0014 | Not tested | LEE | Protein | 1e-21 | 56 |
Z1132 | NP_286667.1 | hypothetical protein | Not tested | TAI | Protein | 3e-21 | 56 |
hp4 | AAC61716.1 | Hp4 | Not tested | PAI I CFT073 | Protein | 1e-21 | 56 |
Z1571 | NP_287075.1 | hypothetical protein | Not tested | TAI | Protein | 3e-21 | 56 |
unnamed | AAL99258.1 | unknown | Not tested | LEE | Protein | 1e-21 | 56 |
c3578 | NP_755453.1 | hypothetical protein | Not tested | PAI I CFT073 | Protein | 2e-21 | 56 |
unnamed | ACU09438.1 | IS66 family element orf2 | Not tested | LEE | Protein | 1e-21 | 56 |
Z4336 | NP_289561.1 | hypothetical protein | Not tested | OI-122 | Protein | 2e-21 | 56 |
Z5097 | NP_290248.1 | prophage-associated protein | Not tested | LEE | Protein | 2e-21 | 56 |
ECs4546 | NP_312573.1 | hypothetical protein | Not tested | LEE | Protein | 2e-21 | 56 |
ECUMN_3327 | YP_002414007.1 | putative transposase ORF2, IS66 family | Not tested | Not named | Protein | 5e-21 | 55 |
c3561 | NP_755436.1 | hypothetical protein | Not tested | PAI I CFT073 | Protein | 5e-21 | 55 |
ECO103_3553 | YP_003223420.1 | hypothetical protein | Not tested | LEE | Protein | 1e-20 | 54 |
aec52 | AAW51735.1 | Aec52 | Not tested | AGI-3 | Protein | 1e-22 | 54 |
Z4316 | NP_289542.1 | hypothetical protein | Not tested | OI-122 | Protein | 1e-20 | 54 |
unnamed | ADD91739.1 | hypothetical protein | Not tested | PAI-I AL862 | Protein | 1e-22 | 54 |
BCAM0247 | YP_002232879.1 | putative transposase | Not tested | BcenGI11 | Protein | 2e-17 | 54 |
pB171ORF50 | CAD66190.1 | ORF50 protein of pB171 | Not tested | PAI III 536 | Protein | 2e-22 | 53 |
l0014 | CAD33776.1 | L0014 protein | Not tested | PAI I 536 | Protein | 1e-13 | 50 |
Z1160 | NP_286695.1 | hypothetical protein | Not tested | TAI | Protein | 1e-18 | 49 |
Z1599 | NP_287103.1 | hypothetical protein | Not tested | TAI | Protein | 1e-18 | 49 |
ECUMN_3364 | YP_002414037.1 | putative transposase ORF2, IS66 family | Not tested | Not named | Protein | 1e-18 | 46 |
ECO103_3567 | YP_003223430.1 | hypothetical protein | Not tested | LEE | Protein | 7e-18 | 45 |
Z4338 | NP_289563.1 | hypothetical protein | Not tested | OI-122 | Protein | 7e-18 | 45 |
Z1163 | NP_286698.1 | hypothetical protein | Not tested | TAI | Protein | 1e-09 | 44 |
Z1602 | NP_287106.1 | hypothetical protein | Not tested | TAI | Protein | 1e-09 | 44 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
RHE_CH02015 | YP_469527.1 | insertion sequence transposase | VFG1052 | Protein | 1e-21 | 56 |
RHE_CH02015 | YP_469527.1 | insertion sequence transposase | VFG1709 | Protein | 6e-22 | 56 |
RHE_CH02015 | YP_469527.1 | insertion sequence transposase | VFG0792 | Protein | 6e-22 | 56 |
RHE_CH02015 | YP_469527.1 | insertion sequence transposase | VFG1698 | Protein | 1e-21 | 55 |
RHE_CH02015 | YP_469527.1 | insertion sequence transposase | VFG1665 | Protein | 8e-23 | 53 |
RHE_CH02015 | YP_469527.1 | insertion sequence transposase | VFG1517 | Protein | 4e-14 | 50 |
RHE_CH02015 | YP_469527.1 | insertion sequence transposase | VFG1737 | Protein | 4e-19 | 46 |