Gene Information

Name : RHE_CH02015 (RHE_CH02015)
Accession : YP_469527.1
Strain : Rhizobium etli CFN 42
Genome accession: NC_007761
Putative virulence/resistance : Unknown
Product : insertion sequence transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 2109497 - 2109790 bp
Length : 294 bp
Strand : -
Note : similar to hypothetical protein (in IS1131) [Agrobacterium tumefaciens] and Z0366 (in ISEc8)[Escherichia coli O157:H7 EDL933]; Similar to entrez-protein:JC1151; location:bacterial cytoplasm Psort-Score: 0.1184

DNA sequence :
ATGCGGCGTGGCATTGATGGTCTGTCCGCGCTGGTCGAGACGGTCGTGAGGGAGGCACCGGGCTCGGGCGCAATCTTCGG
CTTTCGCGGAAAACGCGCGGACCGGATCAAGCTGCTTTGGTGGGATGGCCAGGGGTTCTGTCTGTTCTACAAGATTTTGG
AGCGCGGATACTTTCCCTGGCCGACGGCGAAAGAGGGTGTAGCGCACCTGACGCAGGCGCAGCTTTCGATGCTCGTTGAG
GGGATCGATTGGCGACGCCCGGCGTGGACTTCCGCTCCCGGCCGAACGGGATAA

Protein sequence :
MRRGIDGLSALVETVVREAPGSGAIFGFRGKRADRIKLLWWDGQGFCLFYKILERGYFPWPTAKEGVAHLTQAQLSMLVE
GIDWRRPAWTSAPGRTG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-21 56
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-21 56
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-21 56
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 3e-21 56
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-21 56
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 3e-21 56
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-21 56
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-21 56
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-21 56
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-21 56
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-21 56
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-21 55
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-21 55
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-22 54
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-20 54
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-22 54
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-20 54
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-17 54
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-22 53
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-13 50
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-18 49
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-18 49
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-18 46
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 7e-18 45
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 7e-18 45
Z1602 NP_287106.1 hypothetical protein Not tested TAI Protein 1e-09 44
Z1163 NP_286698.1 hypothetical protein Not tested TAI Protein 1e-09 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RHE_CH02015 YP_469527.1 insertion sequence transposase VFG1052 Protein 1e-21 56
RHE_CH02015 YP_469527.1 insertion sequence transposase VFG1709 Protein 6e-22 56
RHE_CH02015 YP_469527.1 insertion sequence transposase VFG0792 Protein 6e-22 56
RHE_CH02015 YP_469527.1 insertion sequence transposase VFG1698 Protein 1e-21 55
RHE_CH02015 YP_469527.1 insertion sequence transposase VFG1665 Protein 8e-23 53
RHE_CH02015 YP_469527.1 insertion sequence transposase VFG1517 Protein 4e-14 50
RHE_CH02015 YP_469527.1 insertion sequence transposase VFG1737 Protein 4e-19 46