Gene Information

Name : feuP (RHE_CH01286)
Accession : YP_468818.1
Strain : Rhizobium etli CFN 42
Genome accession: NC_007761
Putative virulence/resistance : Virulence
Product : two-component response regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1332690 - 1333361 bp
Length : 672 bp
Strand : +
Note : similar to FeuP [Rhizobium leguminosarum] and feuP (SMc00458) [Sinorhizobium meliloti]; Similar to entrez-protein:CAA62008.1; location:bacterial cytoplasm Psort-Score: 0.3718

DNA sequence :
ATGCGCATCCTGGTAATCGAAGACGACGTCAATCTGAACCGGCAGCTCACCGACACGCTGAAGGAGGCGGGCTATGTCGT
CGATCAGGCATTCGACGGCGAGGAAGGCCATTTCCTCGGCGACACCGAACCCTATGACGCCATCATCCTCGATATCGGCT
TGCCTGAGATGGACGGCGTCACCGTGCTGGAAAAATGGCGCGGCGCCGGCCGCGGCATGCCGGTTCTGATCCTGACGGCG
CGCGACCGCTGGAGCGACAAGGTCGCCGGCATCGACGCCGGCGCCGACGACTATGTCACCAAGCCCTTTCACGTCGAGGA
AGTTCTGGCGCGCATTCGGGCGTTGATCCGGCGTGCAGCCGGCCATGCTTCCTCCGAGATCATCTGCGGACCGGTGCGGC
TCGATACCAAATCCTCGAAGGCGACGGTCAACGGCGCGGCGCTGAAGCTGACCTCGCACGAATATCGCCTGCTCGCCTAT
CTCATGCATCACATGGGCGAGGTCGTCTCGCGCACGGAATTGGTCGAGCACATGTACGACCAAGATTTCGACCGCGATTC
CAATACGATCGAGGTCTTCGTCGGCCGTCTGCGCAAGAAGATGGGCGTCGACTTGATCGAAACGGTGCGCGGTCTCGGCT
ACCGCATCCAAGCGCCGAAACATGCGAATTAA

Protein sequence :
MRILVIEDDVNLNRQLTDTLKEAGYVVDQAFDGEEGHFLGDTEPYDAIILDIGLPEMDGVTVLEKWRGAGRGMPVLILTA
RDRWSDKVAGIDAGADDYVTKPFHVEEVLARIRALIRRAAGHASSEIICGPVRLDTKSSKATVNGAALKLTSHEYRLLAY
LMHHMGEVVSRTELVEHMYDQDFDRDSNTIEVFVGRLRKKMGVDLIETVRGLGYRIQAPKHAN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-24 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-25 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
feuP YP_468818.1 two-component response regulator protein CP000647.1.gene1136. Protein 3e-36 46
feuP YP_468818.1 two-component response regulator protein NC_002516.2.879194.p Protein 6e-39 46
feuP YP_468818.1 two-component response regulator protein BAC0530 Protein 2e-36 46
feuP YP_468818.1 two-component response regulator protein CP001918.1.gene2526. Protein 9e-36 45
feuP YP_468818.1 two-component response regulator protein CP001138.1.gene1939. Protein 1e-36 45
feuP YP_468818.1 two-component response regulator protein CP004022.1.gene1005. Protein 4e-40 44
feuP YP_468818.1 two-component response regulator protein NC_002695.1.913289.p Protein 7e-36 44
feuP YP_468818.1 two-component response regulator protein CP000034.1.gene2022. Protein 2e-36 44
feuP YP_468818.1 two-component response regulator protein BAC0111 Protein 9e-31 43
feuP YP_468818.1 two-component response regulator protein BAC0347 Protein 6e-28 42
feuP YP_468818.1 two-component response regulator protein BAC0197 Protein 2e-28 41
feuP YP_468818.1 two-component response regulator protein BAC0308 Protein 1e-25 41
feuP YP_468818.1 two-component response regulator protein BAC0487 Protein 1e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
feuP YP_468818.1 two-component response regulator protein VFG0475 Protein 1e-36 45
feuP YP_468818.1 two-component response regulator protein VFG0596 Protein 1e-25 42
feuP YP_468818.1 two-component response regulator protein VFG1390 Protein 7e-26 41